• Gene id: 339345

Gene Summary

• Gene Symbol: NANOS2   Gene   UCSC   Ensembl
• Aliases: NOS2, ZC2HC12B
• Gene name: nanos C2HC-type zinc finger 2
• Alternate names: nanos homolog 2, NOS-2,
• Gene location: 19q13.32 (45914777: 45913213)     Exons: 1     NC_000019.10
• OMIM: 608228

SNPs

rs1422627

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.45913480C>G
NC_000019.10   g.45913480C>T
NC_000019.9   g.46416738C>G
NC_000019.9   g.46416738C>T
NM_001029861.2   c.*797G>C
NM_001029861.2   c.*797G>A
NM_001029861.3   c.*797G>C
NM_001029861.3   c.*797G>A|SEQ=[C/G/T]|GENE=NANOS2

rs9304651

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.45916515A>G
NC_000019.9   g.46419773A>G|SEQ=[A/G]|GENE=NANOS2

rs2015728

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.45915628G>A
NC_000019.10   g.45915628G>T
NC_000019.9   g.46418886G>A
NC_000019.9   g.46418886G>T|SEQ=[G/A/T]|GENE=NANOS2

Protein Summary

• Protein general information: P60321  
  • Name: Nanos homolog 2 (NOS 2)
  • Length: 138  
  • Mass: 15,132
• Sequence:

  MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHV
  YSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR

• Structural information:
  • Interpro: IPR008705  IPR038129  IPR024161  
  • Prosite: PS51522
  • STRING: ENSP00000341021
• Other Databases: GeneCards:  NANOS2  Malacards:  NANOS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	ISS	cellular component
GO:0003729	mRNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006402	mRNA catabolic process	ISS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030718	germ-line stem cell population maintenance	ISS	biological process
GO:0045835	negative regulation of meiotic nuclear division	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0000932	P-body	ISS	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0006402	mRNA catabolic process	ISS	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030718	germ-line stem cell population maintenance	IEA	biological process
GO:0030718	germ-line stem cell population maintenance	ISS	biological process
GO:0045835	negative regulation of meiotic nuclear division	IEA	biological process
GO:0045835	negative regulation of meiotic nuclear division	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:0000932	P-body	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006402	mRNA catabolic process	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030718	germ-line stem cell population maintenance	ISS	biological process
GO:0045835	negative regulation of meiotic nuclear division	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process

Diseases

Associated diseases	References
Spermatogenesis defects	MIK: 19168545
Male infertility	MIK: 30322389
Cryptorchidism	MIK: 30322389
Nonobstructive azoospermia	MIK: 29790874
Spermatogenesis defects	MIK: 19168545

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19168545	Spermatogenesis	H68Q, H109H		614 (214 males with isolated sterility and spermatogenic abnormalities, 400 fertile males)	Male infertility
30322389	Male infertility, cryptorchidism				Male infertility
29790874	Nonobstructive azoospermia	c.C208T (p.Gly70Arg)		37 familial cases, 75 individuals with idiopathic NOA, 74 fertile men	Male infertility	NGS