• Gene id: 339145

Gene Summary

• Gene Symbol: CIBAR2   Gene   UCSC   Ensembl
• Aliases: FAM92B
• Gene name: CBY1 interacting BAR domain containing 2
• Alternate names: protein FAM92B, family with sequence similarity 92 member B,
• Gene location: 16q24.1 (130896811: 130892706)     Exons: 3     NC_000009.12
• OMIM: 617274

Protein Summary

• Protein general information: Q6ZTR7  
  • Name: Protein FAM92B
  • Length: 304  
  • Mass: 34755
  • Tissue specificity: Restricted to certain tissues, most prominently expressed in multicilaited tissues. {ECO
• Sequence:

  MNIVFSRDSQVRVMENTVANTEKYFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANSENPELRATMRGFAEDL
  AKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNHEIKQLEKLEKLRQKSPSDQQMIGQAETRVQ
  RAAVDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFHAKAVEVYSSAFQTLEKYDLERDLLDFRAKMQG
  VYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGGHLMLP
  GHSL

• Structural information:
  • Interpro: IPR027267  IPR035590  IPR009602  
  • CDD: cd07598
  • STRING: ENSP00000443411
• Other Databases: GeneCards:  CIBAR2  Malacards:  CIBAR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005814	centriole	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq