• Gene id: 338872

Gene Summary

• Gene Symbol: C1QTNF9   Gene   UCSC   Ensembl
• Aliases: AQL1, C1QTNF9A, CTRP9
• Gene name: C1q and TNF related 9
• Alternate names: complement C1q and tumor necrosis factor-related protein 9A, C1q and tumor necrosis factor related protein 9, complement C1q and tumor necrosis factor-related protein 9, complement C1q tumor necrosis factor-related protein 9, complement C1q tumor necrosis fac,
• Gene location: 13q12.12 (24307165: 24322530)     Exons: 6     NC_000013.11
• OMIM: 612040

Protein Summary

• Protein general information: P0C862  
  • Name: Complement C1q and tumor necrosis factor related protein 9A (Complement C1q and tumor necrosis factor related protein 9)
  • Length: 333  
  • Mass: 34681
  • Tissue specificity: Expressed predominantly in adipose tissue. {ECO
• Sequence:

  MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGE
  RGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGL
  PGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDK
  ILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDE
  VWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP

• Structural information:
  • Protein Domains: (24..8-)
    (/note="Collagen-like-1)
    (95..15-)
    (/note="Collagen-like-2)
    (155..19-)
    (/note="Collagen-like-3)
    (197..33-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR008160  IPR008983  
  • Prosite: PS50871
  • STRING: ENSP00000371503
• Other Databases: GeneCards:  C1QTNF9  Malacards:  C1QTNF9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005581	collagen trimer	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881