• Gene id: 338811

Gene Summary

• Gene Symbol: TAFA2   Gene   UCSC   Ensembl
• Aliases: FAM19A2, TAFA-2
• Gene name: TAFA chemokine like family member 2
• Alternate names: chemokine-like protein TAFA-2, family with sequence similarity 19 (chemokine (C-C motif)-like), member A2, family with sequence similarity 19 member A2, C-C motif chemokine like, protein FAM19A2,
• Gene location: 12q14.1 (62260103: 61708247)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
• OMIM: 600831

Protein Summary

• Protein general information: Q8N3H0  
  • Name: Chemokine like protein TAFA 2
  • Length: 131  
  • Mass: 14620
  • Tissue specificity: Brain-specific. {ECO
• Sequence:

  MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVA
  GTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

• Structural information:
  • Interpro: IPR020350  
  • STRING: ENSP00000393987
• Other Databases: GeneCards:  TAFA2  Malacards:  TAFA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0048018	receptor ligand activity	IBA	molecular function
GO:0007613	memory	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0008542	visual learning	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0048018	receptor ligand activity	IBA	molecular function
GO:0007613	memory	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0008542	visual learning	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray