• Gene id: 3386

Gene Summary

• Gene Symbol: ICAM4   Gene   UCSC   Ensembl
• Aliases: CD242, LW
• Gene name: intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
• Alternate names: intercellular adhesion molecule 4, CD242 antigen, LW antigen a, Landsteiner-Wiener blood group antigen a, Landsteiner-Wiener blood group glycoprotein, intercellular adhesion molecule 4 (LW blood group),
• Gene location: 19p13.2 (10286954: 10288519)     Exons: 3     NC_000019.10
• Gene summary(Entrez): This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-ty
• OMIM: 608915

SNPs

rs5498

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.10285007A>G
NC_000019.9   g.10395683A>G
NG_012083.1   g.19167A>G
NM_000201.3   c.1405A>G
NM_000201.2   c.1405A>G
NG_007728.1   g.3034A>G
NP_000192.2   p.Lys469Glu|SEQ=[A/G]|GENE=ICAM1
ICAM4   3386

Protein Summary

• Protein general information: Q14773  
  • Name: Intercellular adhesion molecule 4 (ICAM 4) (Landsteiner Wiener blood group glycoprotein) (LW blood group protein) (CD antigen CD242)
  • Length: 271  
  • Mass: 29265
  • Tissue specificity: Erythrocytes.
• Sequence:

  MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQ
  PQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYT
  LRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSS
  APITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA

• Structural information:
  • Protein Domains: (62..12-)
    1 (/note="Ig-like-C2-type)
    (146..21-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR013768  IPR003987  IPR036179  IPR013783  
  • STRING: ENSP00000342114
• Other Databases: GeneCards:  ICAM4  Malacards:  ICAM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005178	integrin binding	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005178	integrin binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq