• Gene id: 338567

Gene Summary

• Gene Symbol: KCNK18   Gene   UCSC   Ensembl
• Aliases: K2p18.1, MGR13, TRESK, TRESK-2, TRESK2, TRIK
• Gene name: potassium two pore domain channel subfamily K member 18
• Alternate names: potassium channel subfamily K member 18, TWIK-related individual K+ channel, TWIK-related individual potassium channel, TWIK-related spinal cord K+ channel, TWIK-related spinal cord potassium channel, potassium channel, subfamily K, member 18, potassium channel,
• Gene location: 10q25.3 (117197488: 117210298)     Exons: 3     NC_000010.11
• Gene summary(Entrez): Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes a member of the superfamily of potassium channel proteins c

Protein Summary

• Protein general information: Q7Z418  
  • Name: Potassium channel subfamily K member 18 (TWIK related individual potassium channel) (TWIK related spinal cord potassium channel)
  • Length: 384  
  • Mass: 43671
  • Tissue specificity: Expressed specifically in dorsal root ganglion and trigeminal ganglion neurons. Detected at low levels in spinal cord. {ECO
• Sequence:

  MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEKFLEELCRILNCSETV
  VEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTD
  TGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSM
  ELFERSHALEKQNTLQLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI
  LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQNRLIDIYKNVMLFFAK
  GKFYHLVKK

• Structural information:
  • Interpro: IPR003280  IPR013099  
  • STRING: ENSP00000334650
• Other Databases: GeneCards:  KCNK18  Malacards:  KCNK18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0015271	outward rectifier potassium channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006813	potassium ion transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0015271	outward rectifier potassium channel activity	IDA	molecular function
GO:0097623	potassium ion export across plasma membrane	IDA	biological process
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0071467	cellular response to pH	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0015271	outward rectifier potassium channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006813	potassium ion transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0015271	outward rectifier potassium channel activity	IDA	molecular function
GO:0097623	potassium ion export across plasma membrane	IDA	biological process
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0071467	cellular response to pH	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881