• Gene id: 3385

Gene Summary

• Gene Symbol: ICAM3   Gene   UCSC   Ensembl
• Aliases: CD50, CDW50, ICAM-R
• Gene name: intercellular adhesion molecule 3
• Alternate names: intercellular adhesion molecule 3, ICAM-3,
• Gene location: 19p13.2 (10339623: 10333775)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein.
• OMIM: 612600

Protein Summary

• Protein general information: P32942  
  • Name: Intercellular adhesion molecule 3 (ICAM 3) (CDw50) (ICAM R) (CD antigen CD50)
  • Length: 547  
  • Mass: 59541
  • Tissue specificity: Leukocytes. {ECO
• Sequence:

  MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVA
  SGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQVEDGSPRTSL
  TVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRL
  VAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATATARADQEGAREIVCNVTLGG
  ERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVPAAAPGQPAQLQLNATESDDGRSFFC
  SATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHVLQCQARGNPYPELRCLKEGSSREVPVGIPF
  FVNVTHNGTYQCQASSSRGKYTLVVVMDIEAGSSHFVPVFVAVLLTLGVVTIVLALMYVFREHQRSGSYHVREES
  TYLPLTSMQPTEAMGEEPSRAE

• Structural information:
  • Protein Domains: (46..10-)
    1 (/note="Ig-like-C2-type)
    (132..19-)
    2 (/note="Ig-like-C2-type)
    (234..30-)
    3 (/note="Ig-like-C2-type)
    (329..38-)
    4 (/note="Ig-like-C2-type)
    (416..46-)
    5" (/note="Ig-like-C2-type)
  • Interpro: IPR003988  IPR013768  IPR003987  IPR007110  IPR036179   IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 1T0P
  • PDBsum: 1T0P
  • STRING: ENSP00000160262
• Other Databases: GeneCards:  ICAM3  Malacards:  ICAM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005178	integrin binding	IBA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006909	phagocytosis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005178	integrin binding	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881