• Gene id: 338339

Gene Summary

• Gene Symbol: CLEC4D   Gene   UCSC   Ensembl
• Aliases: CD368, CLEC-6, CLEC6, CLECSF8, Dectin-3, MCL, MPCL
• Gene name: C-type lectin domain family 4 member D
• Alternate names: C-type lectin domain family 4 member D, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8, C-type lectin receptor, C-type lectin superfamily member 8, C-type lectin-like receptor 6, Dectin 3, macrophage C-type lectin,
• Gene location: 12p13.31 (8513491: 8522365)     Exons: 7     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
• OMIM: 608270

Protein Summary

• Protein general information: Q8WXI8  
  • Name: C type lectin domain family 4 member D (C type lectin superfamily member 8) (C type lectin like receptor 6) (CLEC 6) (CD antigen CD368)
  • Length: 215  
  • Mass: 24704
  • Tissue specificity: Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma. {ECO
• Sequence:

  MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKS
  AEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENA
  KGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

• Structural information:
  • Protein Domains: (91..20-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR033989  IPR016187  
  • Prosite: PS50041
  • CDD: cd03590
  • PDB: 2LS8 3WHD
  • PDBsum: 2LS8 3WHD
  • STRING: ENSP00000299665
• Other Databases: GeneCards:  CLEC4D  Malacards:  CLEC4D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030887	positive regulation of myeloid dendritic cell activation	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0038094	Fc-gamma receptor signaling pathway	IEA	biological process
GO:0002292	T cell differentiation involved in immune response	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0034987	immunoglobulin receptor binding	IEA	molecular function
GO:0030887	positive regulation of myeloid dendritic cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881