• Gene id: 3383

Gene Summary

• Gene Symbol: ICAM1   Gene   UCSC   Ensembl
• Aliases: BB2, CD54, P3.58
• Gene name: intercellular adhesion molecule 1
• Alternate names: intercellular adhesion molecule 1, ICAM-1, cell surface glycoprotein P3.58, intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, major group rhinovirus receptor,
• Gene location: 19p13.2 (10270840: 10286614)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by Ref
• OMIM: 147840

SNPs

rs5498

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.10285007A>G
NC_000019.9   g.10395683A>G
NG_012083.1   g.19167A>G
NM_000201.3   c.1405A>G
NM_000201.2   c.1405A>G
NG_007728.1   g.3034A>G
NP_000192.2   p.Lys469Glu|SEQ=[A/G]|GENE=ICAM1
ICAM4   3386

Protein Summary

• Protein general information: P05362  
  • Name: Intercellular adhesion molecule 1 (ICAM 1) (Major group rhinovirus receptor) (CD antigen CD54)
  • Length: 532  
  • Mass: 57,825
• Sequence:

  MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNN
  RKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVL
  LRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPR
  VLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
  TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATL
  EVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRD
  LEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKP
  NTQATPP

• Structural information:
  • Protein Domains: Ig-like (41-103)
    Ig-like (128-193)
    Ig-like (230-297)
    Ig-like (325-378)
    Ig-like (412-464)
  • Interpro: IPR003988  IPR013768  IPR003987  IPR036179  IPR013783   IPR003599  
  • PDB: 1D3E 1D3I 1D3L 1IAM 1IC1 1IJ4 1MQ8 1P53 1Z7Z 2OZ4 3TCX 5MZA 6EIT
  • PDBsum: 1D3E 1D3I 1D3L 1IAM 1IC1 1IJ4 1MQ8 1P53 1Z7Z 2OZ4 3TCX 5MZA 6EIT
  • DIP: 36658
  • STRING: ENSP00000264832
• Other Databases: GeneCards:  ICAM1  Malacards:  ICAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001541	ovarian follicle development	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001772	immunological synapse	IEA	cellular component
GO:0001910	regulation of leukocyte mediated cytotoxicity	TAS	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0002291	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	biological process
GO:0002438	acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0002457	T cell antigen processing and presentation	IEA	biological process
GO:0002693	positive regulation of cellular extravasation	IMP	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	biological process
GO:0007159	leukocyte cell-cell adhesion	IMP	biological process
GO:0007569	cell aging	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010212	response to ionizing radiation	IEA	biological process
GO:0010477	response to sulfur dioxide	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0031669	cellular response to nutrient levels	IEA	biological process
GO:0033627	cell adhesion mediated by integrin	IEA	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0044406	adhesion of symbiont to host	IDA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	IEP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0051926	negative regulation of calcium ion transport	IEA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071312	cellular response to alkaloid	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0097368	establishment of Sertoli cell barrier	IEA	biological process
GO:1900027	regulation of ruffle assembly	IEA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0001772	immunological synapse	IEA	cellular component
GO:0001910	regulation of leukocyte mediated cytotoxicity	TAS	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0002291	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	biological process
GO:0002438	acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0002457	T cell antigen processing and presentation	IEA	biological process
GO:0002693	positive regulation of cellular extravasation	IMP	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	biological process
GO:0007159	leukocyte cell-cell adhesion	IEA	biological process
GO:0007159	leukocyte cell-cell adhesion	IMP	biological process
GO:0007569	cell aging	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010212	response to ionizing radiation	IEA	biological process
GO:0010477	response to sulfur dioxide	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016337	single organismal cell-cell adhesion	IEA	biological process
GO:0016337	single organismal cell-cell adhesion	IEA	biological process
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0031669	cellular response to nutrient levels	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0033627	cell adhesion mediated by integrin	IEA	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0044406	adhesion of symbiont to host	IDA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	IEP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0051926	negative regulation of calcium ion transport	IEA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0071312	cellular response to alkaloid	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0097368	establishment of Sertoli cell barrier	IEA	biological process
GO:1900027	regulation of ruffle assembly	IEA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:0001910	regulation of leukocyte mediated cytotoxicity	TAS	biological process
GO:0002291	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	biological process
GO:0002693	positive regulation of cellular extravasation	IMP	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	biological process
GO:0007159	leukocyte cell-cell adhesion	IMP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0022614	membrane to membrane docking	IEP	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0044406	adhesion of symbiont to host	IDA	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	IEP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0061028	establishment of endothelial barrier	IGI	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04514	Cell adhesion molecules
hsa04650	Natural killer cell mediated cytotoxicity
hsa04670	Leukocyte transendothelial migration
hsa05323	Rheumatoid arthritis
hsa05418	Fluid shear stress and atherosclerosis
hsa05416	Viral myocarditis
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05150	Staphylococcus aureus infection
hsa05166	Human T-cell leukemia virus 1 infection
hsa05164	Influenza A
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05144	Malaria
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Cancer (meningeal)	GAD: 20406964
Cancer (myeloma)	GAD: 20568250
Cancer (prostate)	GAD: 16733712
Malignant melanoma	GAD: 16313300
Cancer	GAD: 19822019
Cancer (bladder)	GAD: 19692168
Cancer (colorectal)	GAD: 16937502
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (head and neck)	GAD: 20819778
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 17361014
Cancer (lymphoma)	GAD: 18633131
Cancer (melanoma)	GAD: 16432463
Cancer (breast)	GAD: 18474291
Angina pectoris	GAD: 18848929
Arterial Occlusive Diseases	GAD: 12192299
Atherosclerosis	GAD: 15682683
Cardiovascular disease	GAD: 16184405
Cerebrovascular disease	GAD: 12871600
Brain ischemia	GAD: 19028820
Peripheral vascular disease	GAD: 19435865
Restenosis	GAD: 12082592
Thrombosis	GAD: 20508517
Gastroschisis	GAD: 17051589
Graves disease	GAD: 14557478
Retinopathy	GAD: 16759306
Uveitis	GAD: 20445114
Graves ophthalmopathy	GAD: 17521325
Hodgkin disease	GAD: 19573080
Allergy	GAD: 11354638
Arthritis	GAD: 11981324
Asthma	GAD: 16625213
Behcet's disease	GAD: 19906207
Celiac disease	GAD: 16916657
Cholangitis	GAD: 16750586
Chronic ulcerative colitis	GAD: 15334773
Crohn's disease	GAD: 15958080
Inflammatory bowel disease	GAD: 12477764
Multiple sclerosis	GAD: 12590979
Periodontitis	GAD: 16512757
Biliary atresia	GAD: 18401716
Diabetes	GAD: 10902613
Hypercholesterolemia	GAD: 20602615
Insulin resistance	GAD: 20494378
Bone diseases	GAD: 17390085
Polymyalgia rheumatica	GAD: 10813290
Migraine disorder	GAD: 19559392
Multiple system atrophy	GAD: 15607204
Vascular dementia	GAD: 12095649
Stroke	GAD: 18791855
Giant cell arteritis	GAD: 11469468
Alzheimer's disease	GAD: 19141999
Amyotrophic lateral sclerosis (ALS)	GAD: 18513389
Parkinson disease	GAD: 12524171
Psychological disorders	GAD: 12095649
Schizophrenia	GAD: 15756053
Dementia	GAD: 12095649
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 18627514
Chronic kidney failure	GAD: 19578796
Premature birth	GAD: 18851856
Endometriosis	INFBASE: 20160446
Pelvic endometriosis	INFBASE: 11937115
Defective endometrial receptivity	INFBASE: 25935494
Endometriosis	INFBASE: 14688178
Female infertility	INFBASE: 9848307
Endometriosis-associated infertility	INFBASE: 11326914
Endometriosis	INFBASE: 11716965
Polycystic ovary syndrome (PCOS)	INFBASE: 16968464
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Endometriosis	INFBASE: 12846675
Female infertility	INFBASE: 12846675
Polycystic ovary syndrome (PCOS)	INFBASE: 26498675
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Ovarian function	INFBASE: 9548172
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 16028375
Tubal damage	INFBASE: 12846675
Male factor infertility	MIK: 25597177
Non obstructive azoospermia	MIK: 30704307
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Erythema	GAD: 14760823
Adult respiratory distress syndrome	GAD: 11893710
Albuminuria	GAD: 15736117
Cryptorchidism	MIK: 28606200
Male immune infertility	MIK: 25597177

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25597177	Male immune infertility			123 (immune infertility group (n = 41), other infertility group A (n = 37), and other infertility group B (n = 45))	Male infertility	IL6  ICAM-1
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq