• Gene id: 3375

Gene Summary

• Gene Symbol: IAPP   Gene   UCSC   Ensembl
• Aliases: DAP, IAP
• Gene name: islet amyloid polypeptide
• Alternate names: islet amyloid polypeptide, Islet amyloid polypeptide (diabetes-associated peptide; amylin), amylin, diabetes-associated peptide, insulinoma amyloid peptide,
• Gene location: 12p12.1 (21354959: 21379979)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type
• OMIM: 147940

Protein Summary

• Protein general information: P10997  
  • Name: Islet amyloid polypeptide (Amylin) (Diabetes associated peptide) (DAP) (Insulinoma amyloid peptide)
  • Length: 89  
  • Mass: 9806
• Sequence:

  MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNA
  VEVLKREPLNYLPL

• Structural information:
  • Interpro: IPR021117  IPR021116  IPR018360  IPR001693  IPR000443  
  • Prosite: PS00258
  • PDB: 1KUW 2G48 2KB8 2L86 3DG1 3FPO 3FR1 3FTH 3FTK 3FTL 3FTR 3G7V 3G7W 3HGZ 5K5G 5KNZ 5KO0 5MGQ
  • PDBsum: 1KUW 2G48 2KB8 2L86 3DG1 3FPO 3FR1 3FTH 3FTK 3FTL 3FTR 3G7V 3G7W 3HGZ 5K5G 5KNZ 5KO0 5MGQ
  • DIP: 29913
  • STRING: ENSP00000240652
• Other Databases: GeneCards:  IAPP  Malacards:  IAPP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	NAS	biological process
GO:0097647	amylin receptor signaling pathway	ISS	biological process
GO:0097647	amylin receptor signaling pathway	ISS	biological process
GO:0010823	negative regulation of mitochondrion organization	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043410	positive regulation of MAPK cascade	NAS	biological process
GO:1905907	negative regulation of amyloid fibril formation	TAS	biological process
GO:0010739	positive regulation of protein kinase A signaling	NAS	biological process
GO:0031333	negative regulation of protein-containing complex assembly	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	NAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0042755	eating behavior	IEA	biological process
GO:0045779	negative regulation of bone resorption	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0019233	sensory perception of pain	IEA	biological process
GO:0097647	amylin receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04950	Maturity onset diabetes of the young

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:2441214
type 2 diabetes mellitus	PMID:19100955
type 2 diabetes mellitus	PMID:18641056
type 1 diabetes mellitus	PMID:19033417
type 1 diabetes mellitus	PMID:19190104
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)