• Gene id: 3359

Gene Summary

• Gene Symbol: HTR3A   Gene   UCSC   Ensembl
• Aliases: 5-HT-3, 5-HT3A, 5-HT3R, 5HT3R, HTR3
• Gene name: 5-hydroxytryptamine receptor 3A
• Alternate names: 5-hydroxytryptamine receptor 3A, 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic, 5-hydroxytryptamine receptor 3, 5HT3 serotonin receptor, serotonin receptor 3A, serotonin-gated ion channel receptor,
• Gene location: 11q23.2 (42914355: 42909272)     Exons: 5     NC_000007.14
• Gene summary(Entrez): The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge
• OMIM: 182139

Protein Summary

• Protein general information: P46098  
  • Name: 5 hydroxytryptamine receptor 3A (5 HT3 A) (5 HT3A) (5 hydroxytryptamine receptor 3) (5 HT 3) (5 HT3R) (Serotonin receptor 3A) (Serotonin gated ion channel receptor)
  • Length: 478  
  • Mass: 55280
  • Tissue specificity: Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta. {ECO
• Sequence:

  MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDE
  KNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKP
  LQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMES
  SNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
  GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQSTSQRPPATSQATKT
  DDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEIREVARDWLRVGSVLD
  KLLFHIYLLAVLAYSITLVMLWSIWQYA

• Structural information:
  • Interpro: IPR008132  IPR008133  IPR006202  IPR036734  IPR006201   IPR036719  IPR006029  IPR018000  
  • Prosite: PS00236
  • STRING: ENSP00000347754
• Other Databases: GeneCards:  HTR3A  Malacards:  HTR3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050877	nervous system process	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0022850	serotonin-gated cation-selective channel activity	IBA	molecular function
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051378	serotonin binding	IDA	molecular function
GO:0022850	serotonin-gated cation-selective channel activity	IDA	molecular function
GO:0032154	cleavage furrow	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0032414	positive regulation of ion transmembrane transporter activity	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0022850	serotonin-gated cation-selective channel activity	IEA	molecular function
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042220	response to cocaine	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0022850	serotonin-gated cation-selective channel activity	IDA	molecular function
GO:1904602	serotonin-activated cation-selective channel complex	IDA	cellular component
GO:0007210	serotonin receptor signaling pathway	IEA	biological process
GO:0007210	serotonin receptor signaling pathway	IEA	biological process
GO:0007210	serotonin receptor signaling pathway	IEA	biological process
GO:0007210	serotonin receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04726	Serotonergic synapse
hsa04742	Taste transduction

Diseases

Associated diseases	References
Irritable bowel syndrome	PMID:21420406
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray