• Gene id: 3358

Gene Summary

• Gene Symbol: HTR2C   Gene   UCSC   Ensembl
• Aliases: 5-HT1C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
• Gene name: 5-hydroxytryptamine receptor 2C
• Alternate names: 5-hydroxytryptamine receptor 2C, 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled, 5-hydroxytryptamine receptor 1C, serotonin 5-HT-1C receptor, serotonin 5-HT-2C receptor,
• Gene location: Xq23 (114584077: 114910060)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene encodes a seven-transmembrane G-protein-coupled receptor. The encoded protein responds to signaling through the neurotransmitter serotonin. The mRNA of this gene is subject to multiple RNA editing events, where adenosine residues encoded by the

Protein Summary

• Protein general information: P28335  
  • Name: 5 hydroxytryptamine receptor 2C (5 HT 2C) (5 HT2C) (5 HTR2C) (5 hydroxytryptamine receptor 1C) (5 HT 1C) (5 HT1C) (Serotonin receptor 2C)
  • Length: 458  
  • Mass: 51821
  • Tissue specificity: Detected in brain. {ECO
• Sequence:

  MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVI
  MAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISL
  DRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFI
  PLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
  QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIY
  RRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSV
  VSERISSV

• Structural information:
  • Interpro: IPR000377  IPR002231  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 6BQG 6BQH
  • PDBsum: 6BQG 6BQH
  • STRING: ENSP00000276198
• Other Databases: GeneCards:  HTR2C  Malacards:  HTR2C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0051209	release of sequestered calcium ion into cytosol	IBA	biological process
GO:0042493	response to drug	IBA	biological process
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0001587	Gq/11-coupled serotonin receptor activity	IDA	molecular function
GO:0043397	regulation of corticotropin-releasing hormone secretion	ISS	biological process
GO:0032098	regulation of appetite	ISS	biological process
GO:0007208	phospholipase C-activating serotonin receptor signaling pathway	ISS	biological process
GO:0001662	behavioral fear response	ISS	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	ISS	biological process
GO:0031644	regulation of nervous system process	ISS	biological process
GO:0007631	feeding behavior	ISS	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0007626	locomotory behavior	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007610	behavior	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007631	feeding behavior	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0051378	serotonin binding	IDA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001662	behavioral fear response	IEA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0007208	phospholipase C-activating serotonin receptor signaling pathway	IEA	biological process
GO:0032098	regulation of appetite	IEA	biological process
GO:0043397	regulation of corticotropin-releasing hormone secretion	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0031644	regulation of nervous system process	IEA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0051378	serotonin binding	IDA	molecular function
GO:0051378	serotonin binding	IDA	molecular function
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0019934	cGMP-mediated signaling	IDA	biological process
GO:0071886	1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding	IDA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0042493	response to drug	IDA	biological process
GO:0010513	positive regulation of phosphatidylinositol biosynthetic process	IDA	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0007210	serotonin receptor signaling pathway	IMP	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04726	Serotonergic synapse
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04540	Gap junction

Diseases

Associated diseases	References
Bipolar disorder	PMID:8823764
Schizophrenia	PMID:8742444
obesity	PMID:15048662
obesity	PMID:17016522
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881