• Gene id: 3357

Gene Summary

• Gene Symbol: HTR2B   Gene   UCSC   Ensembl
• Aliases: 5-HT(2B), 5-HT-2B, 5-HT2B
• Gene name: 5-hydroxytryptamine receptor 2B
• Alternate names: 5-hydroxytryptamine receptor 2B, 5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B variant b, serotonin receptor 2B,
• Gene location: 2q37.1 (231126171: 231108229)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin
• OMIM: 300531

Protein Summary

• Protein general information: P41595  
  • Name: 5 hydroxytryptamine receptor 2B (5 HT 2B) (5 HT2B) (Serotonin receptor 2B)
  • Length: 481  
  • Mass: 54298
  • Tissue specificity: Ubiquitous. Detected in liver, kidney, heart, pulmonary artery, and intestine. Detected at lower levels in blood, placenta and brain, especially in cerebellum, occipital cortex and frontal cortex. {ECO
• Sequence:

  MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLV
  ILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTASIMHLCAIS
  VDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAA
  FFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
  LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQMLLEIFVWIGYVSSGV
  NPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRS
  STIQSSSIILLDTLLLTENEGDKTEEQVSYV

• Structural information:
  • Interpro: IPR000482  IPR002231  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 4IB4 4NC3 5TUD 5TVN 6DRX 6DRY 6DRZ 6DS0
  • PDBsum: 4IB4 4NC3 5TUD 5TVN 6DRX 6DRY 6DRZ 6DS0
  • STRING: ENSP00000258400
• Other Databases: GeneCards:  HTR2B  Malacards:  HTR2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0042493	response to drug	IBA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IBA	biological process
GO:0050795	regulation of behavior	IMP	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0006939	smooth muscle contraction	IEA	biological process
GO:0050795	regulation of behavior	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042310	vasoconstriction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007610	behavior	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0051378	serotonin binding	IDA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0051378	serotonin binding	IEA	molecular function
GO:0050795	regulation of behavior	IEA	biological process
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0048598	embryonic morphogenesis	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0014033	neural crest cell differentiation	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0003300	cardiac muscle hypertrophy	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0002031	G protein-coupled receptor internalization	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0001755	neural crest cell migration	IEA	biological process
GO:0071502	cellular response to temperature stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process
GO:0051378	serotonin binding	IDA	molecular function
GO:0051378	serotonin binding	IDA	molecular function
GO:0014065	phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0019934	cGMP-mediated signaling	IDA	biological process
GO:0001819	positive regulation of cytokine production	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IDA	biological process
GO:0051000	positive regulation of nitric-oxide synthase activity	IDA	biological process
GO:0042493	response to drug	IDA	biological process
GO:0010513	positive regulation of phosphatidylinositol biosynthetic process	IDA	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042493	response to drug	IDA	biological process
GO:0042493	response to drug	IDA	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051378	serotonin binding	IDA	molecular function
GO:0051378	serotonin binding	IDA	molecular function
GO:0051378	serotonin binding	IDA	molecular function
GO:0051378	serotonin binding	IDA	molecular function
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0070528	protein kinase C signaling	IMP	biological process
GO:0051781	positive regulation of cell division	ISS	biological process
GO:0050715	positive regulation of cytokine secretion	ISS	biological process
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0014827	intestine smooth muscle contraction	IMP	biological process
GO:0014827	intestine smooth muscle contraction	IMP	biological process
GO:0014033	neural crest cell differentiation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0007210	serotonin receptor signaling pathway	IMP	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IMP	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IMP	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IMP	biological process
GO:0016310	phosphorylation	IMP	biological process
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0003007	heart morphogenesis	ISS	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0001755	neural crest cell migration	ISS	biological process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0071502	cellular response to temperature stimulus	ISS	biological process
GO:0042310	vasoconstriction	IMP	biological process
GO:0019722	calcium-mediated signaling	IMP	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IMP	biological process
GO:0005096	GTPase activator activity	ISS	molecular function
GO:0003300	cardiac muscle hypertrophy	ISS	biological process
GO:0001965	G-protein alpha-subunit binding	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04726	Serotonergic synapse
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04540	Gap junction

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R