• Gene id: 3354

Gene Summary

• Gene Symbol: HTR1E   Gene   UCSC   Ensembl
• Aliases: 5-HT1E
• Gene name: 5-hydroxytryptamine receptor 1E
• Alternate names: 5-hydroxytryptamine receptor 1E, 5-HT-1E, 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled, S31, serotonin receptor 1E,
• Gene location: 6q14.3 (86936918: 87020067)     Exons: 2     NC_000006.12
• OMIM: 182132

Protein Summary

• Protein general information: P28566  
  • Name: 5 hydroxytryptamine receptor 1E (5 HT 1E) (5 HT1E) (S31) (Serotonin receptor 1E)
  • Length: 365  
  • Mass: 41682
  • Tissue specificity: Detected in brain. {ECO
• Sequence:

  MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLV
  MPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTIS
  IFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNR
  STDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
  ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT

• Structural information:
  • Interpro: IPR027425  IPR002231  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000307766
• Other Databases: GeneCards:  HTR1E  Malacards:  HTR1E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051378	serotonin binding	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0007198	adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IMP	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0051378	serotonin binding	IDA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04726	Serotonergic synapse
hsa04742	Taste transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)