• Gene id: 3351

Gene Summary

• Gene Symbol: HTR1B   Gene   UCSC   Ensembl
• Aliases: 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
• Gene name: 5-hydroxytryptamine receptor 1B
• Alternate names: 5-hydroxytryptamine receptor 1B, 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled, serotonin 1D beta receptor, serotonin receptor 1B,
• Gene location: 6q14.1 (77463490: 77460923)     Exons: 1     NC_000006.12
• Gene summary(Entrez): The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and a
• OMIM: 602375

Protein Summary

• Protein general information: P28222  
  • Name: 5 hydroxytryptamine receptor 1B (5 HT 1B) (5 HT1B) (S12) (Serotonin 1D beta receptor) (5 HT 1D beta) (Serotonin receptor 1B)
  • Length: 390  
  • Mass: 43568
  • Tissue specificity: Detected in cerebral artery smooth muscle cells (at protein level). Detected in brain cortex, striatum, amygdala, medulla, hippocampus, caudate nucleus and putamen. {ECO
• Sequence:

  MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALITLATTLSNAFVIATVY
  RTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWA
  ITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLI
  ALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
  KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNED
  FKQAFHKLIRFKCTS

• Structural information:
  • Interpro: IPR002147  IPR002231  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 2G1X 4IAQ 4IAR 5V54 6G79
  • PDBsum: 2G1X 4IAQ 4IAR 5V54 6G79
  • STRING: ENSP00000358963
• Other Databases: GeneCards:  HTR1B  Malacards:  HTR1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0071312	cellular response to alkaloid	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0007198	adenylate cyclase-inhibiting serotonin receptor signaling pathway	IDA	biological process
GO:0014063	negative regulation of serotonin secretion	ISS	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0050795	regulation of behavior	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042310	vasoconstriction	IEA	biological process
GO:0046849	bone remodeling	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007610	behavior	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0099626	voltage-gated calcium channel activity involved in regulation of presynaptic cytosolic calcium levels	IEA	molecular function
GO:0099171	presynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0051385	response to mineralocorticoid	IEA	biological process
GO:0051378	serotonin binding	IEA	molecular function
GO:0045471	response to ethanol	IEA	biological process
GO:0042756	drinking behavior	IEA	biological process
GO:0014059	regulation of dopamine secretion	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0099154	serotonergic synapse	IEA	cellular component
GO:0051378	serotonin binding	IEA	molecular function
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0051967	negative regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0044305	calyx of Held	IEA	cellular component
GO:0042220	response to cocaine	IEA	biological process
GO:0032229	negative regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0014053	negative regulation of gamma-aminobutyric acid secretion	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0007631	feeding behavior	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0071502	cellular response to temperature stimulus	IEA	biological process
GO:0046849	bone remodeling	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0014063	negative regulation of serotonin secretion	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0002031	G protein-coupled receptor internalization	IEA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0099509	regulation of presynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04726	Serotonergic synapse
hsa04742	Taste transduction

Diseases

Associated diseases	References
Attention deficit hyperactivity disorder	PMID:12556913
Conduct disorder	PMID:14714219
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881