• Gene id: 3347

Gene Summary

• Gene Symbol: HTN3   Gene   UCSC   Ensembl
• Aliases: HIS2, HTN2, HTN5, PB
• Gene name: histatin 3
• Alternate names: histatin-3, basic histidine-rich protein, histatin-4, histatin-5, histatin-6, histatin-7, histatin-8, histatin-9, histidine-rich protein 3,
• Gene location: 4q13.3 (70028458: 70036537)     Exons: 6     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antif
• OMIM: 610767

Protein Summary

• Protein general information: P15516  
  • Name: Histatin 3 (Basic histidine rich protein) (Hst) (Histidine rich protein 3) (PB) [Cleaved into: Histatin 3; His3 (20 44) peptide (His3 20/44) (His3 (1 25) peptide) (His3 1/25) (Histatin 3 1/25) (Histatin 6); His3 (20 43) peptide (His3 20/43) (His3 (1 24) p
  • Length: 51  
  • Mass: 6149
• Sequence:

  MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

• Structural information:
  • Interpro: IPR030774  IPR030773  
  • STRING: ENSP00000432561
• Other Databases: GeneCards:  HTN3  Malacards:  HTN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0042742	defense response to bacterium	IEA	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0031214	biomineral tissue development	IEA	biological process
GO:0031640	killing of cells of other organism	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0042742	defense response to bacterium	NAS	biological process
GO:0042742	defense response to bacterium	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray