• Gene id: 3338

Gene Summary

• Gene Symbol: DNAJC4   Gene   UCSC   Ensembl
• Aliases: DANJC4, HSPF2, MCG18
• Gene name: DnaJ heat shock protein family (Hsp40) member C4
• Alternate names: dnaJ homolog subfamily C member 4, DnaJ (Hsp40) homolog, subfamily C, member 4, dnaJ-like protein HSPF2, heat shock 40kD protein 2, multiple endocrine neoplasia type 1 candidate protein number 18,
• Gene location: 11q13.1 (64230280: 64234280)     Exons: 25     NC_000011.10
• OMIM: 604189

Protein Summary

• Protein general information: Q9NNZ3  
  • Name: DnaJ homolog subfamily C member 4 (DnaJ like protein HSPF2) (Multiple endocrine neoplasia type 1 candidate protein number 18)
  • Length: 241  
  • Mass: 27593
• Sequence:

  MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSR
  FVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQH
  KQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPP
  SEPTQGPEIVPRGAGP

• Structural information:
  • Protein Domains: (34..9-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR036869  
  • Prosite: PS50076
  • CDD: cd06257
  • STRING: ENSP00000396896
• Other Databases: GeneCards:  DNAJC4  Malacards:  DNAJC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0006986	response to unfolded protein	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0006457	protein folding	NAS	biological process
GO:0016020	membrane	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 18367176
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
18367176	Male infertility				Male infertility	Microarray