• Gene id: 3337

Gene Summary

• Gene Symbol: DNAJB1   Gene   UCSC   Ensembl
• Aliases: HSPF1, Hdj1, Hsp40, RSPH16B, Sis1
• Gene name: DnaJ heat shock protein family (Hsp40) member B1
• Alternate names: dnaJ homolog subfamily B member 1, DnaJ (Hsp40) homolog, subfamily B, member 1, dnaJ protein homolog 1, heat shock 40 kDa protein 1, human DnaJ protein 1, radial spoke 16 homolog B,
• Gene location: 19p13.12 (14530596: 14514763)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular c
• OMIM: 604572

Protein Summary

• Protein general information: P25685  
  • Name: DnaJ homolog subfamily B member 1 (DnaJ protein homolog 1) (Heat shock 40 kDa protein 1) (HSP40) (Heat shock protein 40) (Human DnaJ protein 1) (hDj 1)
  • Length: 340  
  • Mass: 38044
• Sequence:

  MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGS
  GPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSR
  SAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGD
  QTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
  GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

• Structural information:
  • Protein Domains: (2..7-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR002939  IPR001623  IPR018253  IPR008971  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • PDB: 1HDJ 2QLD 3AGX 3AGY 3AGZ 4WB7 6BYR
  • PDBsum: 1HDJ 2QLD 3AGX 3AGY 3AGZ 4WB7 6BYR
  • DIP: 41180
  • STRING: ENSP00000254322
• Other Databases: GeneCards:  DNAJB1  Malacards:  DNAJB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0030544	Hsp70 protein binding	IBA	molecular function
GO:0051087	chaperone binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051085	chaperone cofactor-dependent protein refolding	IDA	biological process
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0097201	negative regulation of transcription from RNA polymerase II promoter in response to stress	IDA	biological process
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006986	response to unfolded protein	TAS	biological process
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0051085	chaperone cofactor-dependent protein refolding	IEA	biological process
GO:0006457	protein folding	IEA	biological process
GO:0061827	sperm head	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030900	forebrain development	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0044183	protein folding chaperone	IEA	molecular function
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0090084	negative regulation of inclusion body assembly	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa05164	Influenza A

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq