• Gene id: 3336

Gene Summary

• Gene Symbol: HSPE1   Gene   UCSC   Ensembl
• Aliases: CPN10, EPF, GROES, HSP10
• Gene name: heat shock protein family E (Hsp10) member 1
• Alternate names: 10 kDa heat shock protein, mitochondrial, 10 kDa chaperonin, chaperonin 10, early-pregnancy factor, epididymis secretory sperm binding protein, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1,
• Gene location: 2q33.1 (197500378: 197503448)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an A
• OMIM: 616609

Protein Summary

• Protein general information: P61604  
  • Name: 10 kDa heat shock protein, mitochondrial (Hsp10) (10 kDa chaperonin) (Chaperonin 10) (CPN10) (Early pregnancy factor) (EPF)
  • Length: 102  
  • Mass: 10932
• Sequence:

  MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPE
  YGGTKVVLDDKDYFLFRDGDILGKYVD

• Structural information:
  • Interpro: IPR020818  IPR037124  IPR018369  IPR011032  
  • Prosite: PS00681
  • CDD: cd00320
  • PDB: 4PJ1
  • PDBsum: 4PJ1
  • STRING: ENSP00000233893
• Other Databases: GeneCards:  HSPE1  Malacards:  HSPE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0046872	metal ion binding	IBA	molecular function
GO:0051087	chaperone binding	IBA	molecular function
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0051087	chaperone binding	TAS	molecular function
GO:0006457	protein folding	TAS	biological process
GO:0006986	response to unfolded protein	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0001649	osteoblast differentiation	HDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881