• Gene id: 333

Gene Summary

• Gene Symbol: APLP1   Gene   UCSC   Ensembl
• Aliases: APLP
• Gene name: amyloid beta precursor like protein 1
• Alternate names: amyloid-like protein 1, amyloid beta (A4) precursor-like protein 1, amyloid precursor-like protein 1,
• Gene location: 19q13.12 (35868444: 35879796)     Exons: 17     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleav

Protein Summary

• Protein general information: P51693  
  • Name: Amyloid like protein 1 (APLP) (APLP 1) [Cleaved into: C30]
  • Length: 650  
  • Mass: 72176
  • Tissue specificity: Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). {ECO
• Sequence:

  MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLCGRLTLHRDLRTGRWE
  PDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRCLPGEFVSEAL
  LVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPGTPDPSGTAVGD
  PSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGM
  PGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALNEHFQSILQTLEEQVSGERQRLVET
  HATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVH
  THLQVIEERVNQSLGLLDQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPK
  GSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSM
  LLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP

• Structural information:
  • Protein Domains: (50..21-)
    (/note="E1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01217-)
    (293..48-)
    (/note="E2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01218"-)
  • Interpro: IPR036669  IPR008155  IPR011178  IPR024329  IPR008154   IPR015849  IPR036454  IPR019745  IPR019543  IPR019744  IPR036176  
  • Prosite: PS00319 PS51869 PS51870 PS00320
  • PDB: 3PMR 3Q7G 3Q7L 3QMK 4RD9 4RDA
  • PDBsum: 3PMR 3Q7G 3Q7L 3QMK 4RD9 4RDA
  • DIP: 30846
  • STRING: ENSP00000221891
• Other Databases: GeneCards:  APLP1  Malacards:  APLP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008201	heparin binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046914	transition metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0005604	basement membrane	TAS	cellular component
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031694	alpha-2A adrenergic receptor binding	IPI	molecular function
GO:0031696	alpha-2C adrenergic receptor binding	IPI	molecular function
GO:0031695	alpha-2B adrenergic receptor binding	IPI	molecular function
GO:0106072	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0071874	cellular response to norepinephrine stimulus	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray