• Gene id: 3329

Gene Summary

• Gene Symbol: HSPD1   Gene   UCSC   Ensembl
• Aliases: CPN60, GROEL, HLD4, HSP-60, HSP60, HSP65, HuCHA60, SPG13
• Gene name: heat shock protein family D (Hsp60) member 1
• Alternate names: 60 kDa heat shock protein, mitochondrial, 60 kDa chaperonin, P60 lymphocyte protein, chaperonin 60, heat shock 60kDa protein 1 (chaperonin), heat shock protein 65, mitochondrial matrix protein P1, short heat shock protein 60 Hsp60s1,
• Gene location: 2q33.1 (197500273: 197486583)     Exons: 13     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria.
• OMIM: 118190

Protein Summary

• Protein general information: P10809  
  • Name: 60 kDa heat shock protein, mitochondrial (EC 3.6.4.9) (60 kDa chaperonin) (Chaperonin 60) (CPN60) (Heat shock protein 60) (HSP 60) (Hsp60) (HuCHA60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein)
  • Length: 573  
  • Mass: 61,055
• Sequence:

  MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTK
  DGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDA
  VIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYIS
  PYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
  KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEII
  EQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPA
  LDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVV
  RTALLDAAGVASLLTTAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF

• Structural information:
  • Interpro: IPR018370  IPR001844  IPR002423  IPR027409  IPR027413   IPR027410  
  • Prosite: PS00296
  • CDD: cd03344
  • PDB: 4PJ1
  • PDBsum: 4PJ1
  • DIP: 58
  • STRING: ENSP00000340019
• Other Databases: GeneCards:  HSPD1  Malacards:  HSPD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0002368	B cell cytokine production	IDA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IDA	biological process
GO:0002842	positive regulation of T cell mediated immune response to tumor cell	IDA	biological process
GO:0003688	DNA replication origin binding	ISS	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005905	clathrin-coated pit	IDA	cellular component
GO:0006458	'de novo' protein folding	ISS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006986	response to unfolded protein	IDA	biological process
GO:0009409	response to cold	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016887	ATPase activity	ISS	molecular function
GO:0030135	coated vesicle	IDA	cellular component
GO:0030141	secretory granule	ISS	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032727	positive regulation of interferon-alpha production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0042026	protein refolding	IDA	biological process
GO:0042100	B cell proliferation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042113	B cell activation	IDA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0048291	isotype switching to IgG isotypes	IDA	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050870	positive regulation of T cell activation	ISS	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0051082	unfolded protein binding	ISS	molecular function
GO:0051082	unfolded protein binding	IC	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051131	chaperone-mediated protein complex assembly	ISS	biological process
GO:0051604	protein maturation	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0019907	cyclin-dependent protein kinase activating kinase holoenzyme complex	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0002368	B cell cytokine production	IDA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IDA	biological process
GO:0002842	positive regulation of T cell mediated immune response to tumor cell	IDA	biological process
GO:0003688	DNA replication origin binding	ISS	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005905	clathrin-coated pit	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0006458	'de novo' protein folding	ISS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006986	response to unfolded protein	IDA	biological process
GO:0009409	response to cold	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016887	ATPase activity	ISS	molecular function
GO:0030135	coated vesicle	IDA	cellular component
GO:0030141	secretory granule	ISS	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032727	positive regulation of interferon-alpha production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0042026	protein refolding	IEA	biological process
GO:0042026	protein refolding	IDA	biological process
GO:0042100	B cell proliferation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042113	B cell activation	IDA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0048291	isotype switching to IgG isotypes	IDA	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050870	positive regulation of T cell activation	ISS	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0051082	unfolded protein binding	ISS	molecular function
GO:0051082	unfolded protein binding	IC	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051131	chaperone-mediated protein complex assembly	ISS	biological process
GO:0051604	protein maturation	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0019907	cyclin-dependent protein kinase activating kinase holoenzyme complex	IDA	cellular component
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0002368	B cell cytokine production	IDA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IDA	biological process
GO:0002842	positive regulation of T cell mediated immune response to tumor cell	IDA	biological process
GO:0003688	DNA replication origin binding	ISS	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005905	clathrin-coated pit	IDA	cellular component
GO:0006458	'de novo' protein folding	ISS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006986	response to unfolded protein	IDA	biological process
GO:0009409	response to cold	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016887	ATPase activity	ISS	molecular function
GO:0030135	coated vesicle	IDA	cellular component
GO:0030141	secretory granule	ISS	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032727	positive regulation of interferon-alpha production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032735	positive regulation of interleukin-12 production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0042026	protein refolding	IDA	biological process
GO:0042100	B cell proliferation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0042113	B cell activation	IDA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0048291	isotype switching to IgG isotypes	IDA	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050870	positive regulation of T cell activation	ISS	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0050870	positive regulation of T cell activation	IDA	biological process
GO:0051082	unfolded protein binding	ISS	molecular function
GO:0051082	unfolded protein binding	IC	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051131	chaperone-mediated protein complex assembly	ISS	biological process
GO:0051604	protein maturation	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0019907	cyclin-dependent protein kinase activating kinase holoenzyme complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04940	Type I diabetes mellitus
hsa05134	Legionellosis
hsa05152	Tuberculosis

Diseases

Associated diseases	References
Coronary heart disease	GAD: 19336475
Cardiovascular disease	GAD: 18320357
Hereditary spastic paraplegia	KEGG: H00266
Multiple sclerosis	GAD: 17420921
Arthritis	GAD: 17925998
Spastic paraplegia	GAD: 17420924
Leukodystrophy	OMIM: 118190
Spastic paraplegia	OMIM: 118190
Alzheimer's disease	GAD: 19141999
Endometriosis	INFBASE: 9689358
Preeclampsia	INFBASE: 24051131
Female infertility	INFBASE: 14750702
Spontaneous abortion	INFBASE: 9689358
Male factor infertility	MIK: 8717331
Female infertility	INFBASE: 18476087
Hypomyelinating leukodystrophy	KEGG: H00679
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 19207617
Male infertility	MIK: 8717331
May affect human sperm intracellular signalling pathways and capacitation	MIK: 17670764

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
8717331	Male infertility				Male infertility
9134866	Male infertility			121 adult men with disturbed fertility	Male infertility
19207617	Involved in spermatogenesis				Male infertility
17670764	May affect human sperm intracellular signalling pathways and capacitation				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray