• Gene id: 3313

Gene Summary

• Gene Symbol: HSPA9   Gene   UCSC   Ensembl
• Aliases: CRP40, CSA, EVPLS, GRP-75, GRP75, HEL-S-124m, HSPA9B, MOT, MOT2, MTHSP75, PBP74, SAAN, SIDBA4
• Gene name: heat shock protein family A (Hsp70) member 9
• Alternate names: stress-70 protein, mitochondrial, 75 kDa glucose-regulated protein, catecholamine-regulated protein 40, epididymis secretory sperm binding protein Li 124m, heat shock 70kD protein 9B, heat shock 70kDa protein 9 (mortalin), mortalin, perinuclear, mortalin-,
• Gene location: 5q31.2 (138575628: 138554881)     Exons: 17     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cogn
• OMIM: 600548

Protein Summary

• Protein general information: P38646  
  • Name: Stress 70 protein, mitochondrial (75 kDa glucose regulated protein) (GRP 75) (Heat shock 70 kDa protein 9) (Mortalin) (MOT) (Peptide binding protein 74) (PBP74)
  • Length: 679  
  • Mass: 73,680
• Sequence:

  MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQA
  KVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNG
  DAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTA
  AALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTK
  DNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEV
  SKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETL
  GGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDID
  ANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFK
  DQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQK
  EEKQ

• Structural information:
  • Interpro: IPR012725  IPR018181  IPR029048  IPR029047  IPR013126  
  • Prosite: PS00297 PS00329 PS01036
  • PDB: 3N8E 4KBO
  • PDBsum: 3N8E 4KBO
  • DIP: 32936
  • STRING: ENSP00000297185
• Other Databases: GeneCards:  HSPA9  Malacards:  HSPA9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0006611	protein export from nucleus	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0017134	fibroblast growth factor binding	IEA	molecular function
GO:0030097	hemopoiesis	IMP	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0006611	protein export from nucleus	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0017134	fibroblast growth factor binding	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0030097	hemopoiesis	IMP	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043209	myelin sheath	IEA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0030097	hemopoiesis	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis

Diseases

Associated diseases	References
Anemia	OMIM: 600548
Parkinson disease	GAD: 19657588
Asthenozoospermia	MIK: 25825237
Asthenozoospermia	MIK: 25825237
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25825237	Asthenozoospermia				Male infertility	Tubulin beta 2B; glutathione S-transferase Mu 3; keratin type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B; sperm protein associated with t
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)