• Gene id: 3312

Gene Summary

• Gene Symbol: HSPA8   Gene   UCSC   Ensembl
• Aliases: HEL-33, HEL-S-72p, HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, LAP-1, LAP1, NIP71
• Gene name: heat shock protein family A (Hsp70) member 8
• Alternate names: heat shock cognate 71 kDa protein, LPS-associated protein 1, N-myristoyltransferase inhibitor protein 71, constitutive heat shock protein 70, epididymis luminal protein 33, epididymis secretory sperm binding protein Li 72p, heat shock 70kDa protein 8, heat shock,
• Gene location: 11q24.1 (123062365: 123057488)     Exons: 10     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a
• OMIM: 600816

SNPs

rs606231461

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000015.10   g.51481268_51481282del
NC_000015.9   g.51773465_51773479del
NG_017155.1   g.146492_146506del
NM_015263.3   c.5827_5841del
NM_015263.4   c.5827_5841del
NM_001174116.1   c.5827_5841del
NM_001174116.2   c.5827_5841del
NM_001174117.1   c.3919_3933del
NM_0  

Protein Summary

• Protein general information: P11142  
  • Name: Heat shock cognate 71 kDa protein (Heat shock 70 kDa protein 8) (Lipopolysaccharide associated protein 1) (LAP 1) (LPS associated protein 1)
  • Length: 646  
  • Mass: 70898
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIG
  RRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYF
  NDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGD
  THLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
  RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAV
  QAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT
  KDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKY
  KAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
  KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

• Structural information:
  • Interpro: IPR018181  IPR029048  IPR029047  IPR013126  
  • Prosite: PS00297 PS00329 PS01036
  • PDB: 3AGY 3AGZ 3ESK 3FZF 3FZH 3FZK 3FZL 3FZM 3LDQ 3M3Z 4H5N 4H5R 4H5T 4H5V 4H5W 4HWI 4KBQ 5AQF 5AQG 5AQH 5AQI 5AQJ 5AQK 5AQL 5AQM 5AQN 5AQO 5AQP 5AQQ 5AQR 5AQS 5AQT 5AQU 5AQV 6B1I 6B1M 6B1N
  • PDBsum: 3AGY 3AGZ 3ESK 3FZF 3FZH 3FZK 3FZL 3FZM 3LDQ 3M3Z 4H5N 4H5R 4H5T 4H5V 4H5W 4HWI 4KBQ 5AQF 5AQG 5AQH 5AQI 5AQJ 5AQK 5AQL 5AQM 5AQN 5AQO 5AQP 5AQQ 5AQR 5AQS 5AQT 5AQU 5AQV 6B1I 6B1M 6B1N
  • DIP: 32874
  • STRING: ENSP00000432083
• Other Databases: GeneCards:  HSPA8  Malacards:  HSPA8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0030674	protein-macromolecule adaptor activity	IPI	molecular function
GO:0101031	chaperone complex	IPI	cellular component
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1904589	regulation of protein import	TAS	biological process
GO:0061635	regulation of protein complex stability	ISS	biological process
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	TAS	biological process
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	IMP	biological process
GO:1904764	chaperone-mediated autophagy translocation complex disassembly	ISS	biological process
GO:0043254	regulation of protein-containing complex assembly	TAS	biological process
GO:0005765	lysosomal membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061684	chaperone-mediated autophagy	ISS	biological process
GO:0061684	chaperone-mediated autophagy	TAS	biological process
GO:0061684	chaperone-mediated autophagy	TAS	biological process
GO:0061741	chaperone-mediated protein transport involved in chaperone-mediated autophagy	NAS	biological process
GO:0009267	cellular response to starvation	TAS	biological process
GO:0042026	protein refolding	IDA	biological process
GO:0098575	lumenal side of lysosomal membrane	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990833	clathrin-uncoating ATPase activity	IBA	molecular function
GO:1990832	slow axonal transport	IBA	biological process
GO:0099524	postsynaptic cytosol	IBA	cellular component
GO:0061741	chaperone-mediated protein transport involved in chaperone-mediated autophagy	IBA	biological process
GO:0061738	late endosomal microautophagy	IBA	biological process
GO:0044183	protein folding chaperone	IBA	molecular function
GO:0042026	protein refolding	IBA	biological process
GO:0034620	cellular response to unfolded protein	IBA	biological process
GO:0031072	heat shock protein binding	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005776	autophagosome	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005524	ATP binding	IBA	molecular function
GO:1904764	chaperone-mediated autophagy translocation complex disassembly	IBA	biological process
GO:0099523	presynaptic cytosol	IBA	cellular component
GO:0061740	protein targeting to lysosome involved in chaperone-mediated autophagy	IBA	biological process
GO:0051787	misfolded protein binding	IBA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0043195	terminal bouton	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0008088	axo-dendritic transport	IBA	biological process
GO:0006986	response to unfolded protein	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0000974	Prp19 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016887	ATPase activity	TAS	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0061202	clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS	cellular component
GO:0061202	clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0070062	extracellular exosome	IEA	cellular component
GO:0061077	chaperone-mediated protein folding	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051085	chaperone cofactor-dependent protein refolding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IEA	biological process
GO:0044829	positive regulation by host of viral genome replication	IEA	biological process
GO:0044788	modulation by host of viral process	IEA	biological process
GO:0006457	protein folding	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0099634	postsynaptic specialization membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098690	glycinergic synapse	IEA	cellular component
GO:0098684	photoreceptor ribbon synapse	IEA	cellular component
GO:0072318	clathrin coat disassembly	IEA	biological process
GO:0061738	late endosomal microautophagy	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0046034	ATP metabolic process	IDA	biological process
GO:1902904	negative regulation of supramolecular fiber organization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0055131	C3HC4-type RING finger domain binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0042026	protein refolding	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0023026	MHC class II protein complex binding	HDA	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0006457	protein folding	NAS	biological process
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0006986	response to unfolded protein	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016887	ATPase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04144	Endocytosis
hsa04141	Protein processing in endoplasmic reticulum
hsa03040	Spliceosome
hsa05162	Measles
hsa04915	Estrogen signaling pathway
hsa05145	Toxoplasmosis
hsa04612	Antigen processing and presentation
hsa04213	Longevity regulating pathway - multiple species
hsa05134	Legionellosis

Diseases

Associated diseases	References
Renal hypertension	PMID:21475814
Hypertension	PMID:17341625
Parkinson's disease	PMID:20697033
Parkinson's disease	PMID:18704197
Multiple sclerosis	PMID:16303141
Multiple sclerosis	PMID:21824468
cervical cancer	PMID:21137014
Macular degeneration	PMID:19684010
colorectal cancer	PMID:19578980
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)