• Gene id: 3310

Gene Summary

• Gene Symbol: HSPA6   Gene   UCSC   Ensembl
• Aliases: HSP70B'
• Gene name: heat shock protein family A (Hsp70) member 6
• Alternate names: heat shock 70 kDa protein 6, epididymis secretory sperm binding protein, heat shock 70 kDa protein B', heat shock 70kD protein 6 (HSP70B'), heat shock 70kDa protein 6 (HSP70B'),
• Gene location: 1q23.3 (161524539: 161526893)     Exons: 1     NC_000001.11
• OMIM: 606919

Protein Summary

• Protein general information: P17066  
  • Name: Heat shock 70 kDa protein 6 (Heat shock 70 kDa protein B')
  • Length: 643  
  • Mass: 71028
• Sequence:

  MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVFDAKRL
  IGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPA
  YFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATA
  GDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
  RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGA
  AVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERA
  MTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAE
  QYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
  LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD

• Structural information:
  • Interpro: IPR018181  IPR029048  IPR029047  IPR013126  
  • Prosite: PS00297 PS00329 PS01036
  • PDB: 3FE1
  • PDBsum: 3FE1
  • STRING: ENSP00000310219
• Other Databases: GeneCards:  HSPA6  Malacards:  HSPA6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005524	ATP binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0031072	heat shock protein binding	IBA	molecular function
GO:0034620	cellular response to unfolded protein	IBA	biological process
GO:0042026	protein refolding	IBA	biological process
GO:0044183	protein folding chaperone	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006986	response to unfolded protein	IBA	biological process
GO:0008180	COP9 signalosome	IBA	colocalizes with
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051787	misfolded protein binding	IBA	molecular function
GO:0008180	COP9 signalosome	IDA	colocalizes with
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006986	response to unfolded protein	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0034605	cellular response to heat	IDA	biological process
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0042026	protein refolding	IDA	biological process
GO:0070370	cellular heat acclimation	IMP	NOT|biological process
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0034605	cellular response to heat	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04144	Endocytosis
hsa04141	Protein processing in endoplasmic reticulum
hsa03040	Spliceosome
hsa05162	Measles
hsa04915	Estrogen signaling pathway
hsa05145	Toxoplasmosis
hsa04612	Antigen processing and presentation
hsa04213	Longevity regulating pathway - multiple species
hsa05134	Legionellosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray