• Gene id: 3308

Gene Summary

• Gene Symbol: HSPA4   Gene   UCSC   Ensembl
• Aliases: APG-2, HEL-S-5a, HS24/P52, HSPH2, RY, hsp70, hsp70RY
• Gene name: heat shock protein family A (Hsp70) member 4
• Alternate names: heat shock 70 kDa protein 4, epididymis secretory sperm binding protein Li 5a, heat shock 70-related protein APG-2, heat shock 70kD protein 4, heat shock 70kDa protein 4, heat shock protein, 110 kDa, hsp70 RY,
• Gene location: 5q31.1 (133051969: 133105016)     Exons: 19     NC_000005.10
• OMIM: 601113

Protein Summary

• Protein general information: P34932  
  • Name: Heat shock 70 kDa protein 4 (HSP70RY) (Heat shock 70 related protein APG 2)
  • Length: 840  
  • Mass: 94,331
• Sequence:

  MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAF
  SDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTD
  AERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLAT
  AFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
  MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGKELSTTLNADEAVTRG
  CALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVFSKNHAAPFSKVLTFYRKEPFTLEAYYSSPQ
  DLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVD
  QEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
  EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKL
  AELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLN
  LQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTA
  VPSDSDKKLPEMDID

• Structural information:
  • Interpro: IPR018181  IPR029048  IPR029047  IPR013126  
  • Prosite: PS00329 PS01036
  • DIP: 460
  • STRING: ENSP00000302961
• Other Databases: GeneCards:  HSPA4  Malacards:  HSPA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0006986	response to unfolded protein	NAS	biological process
GO:0045040	protein import into mitochondrial outer membrane	IDA	biological process
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006986	response to unfolded protein	NAS	biological process
GO:0045040	protein import into mitochondrial outer membrane	IDA	biological process
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0006986	response to unfolded protein	NAS	biological process
GO:0045040	protein import into mitochondrial outer membrane	IDA	biological process
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa04612	Antigen processing and presentation

Diseases

Associated diseases	References
Carotid artery diseases	GAD: 15992611
Bipolar disorder	GAD: 19766166
Preterm birth risk	GAD: 15507967
Preeclampsia	INFBASE: 24051131
Polycystic ovary syndrome (PCOS)	INFBASE: 23825680
Male factor infertility	MIK: 17880957
Varicocele	MIK: 23603921
Oligozoospermia	MIK: 20096881
Endometriosis	INFBASE: 21333981
Connective tissue diseases	GAD: 19527514
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 20369545
Spermatogenic defects	MIK: 24899640
Male infertility	MIK: 17880957
Nonobstructive azoospermia	MIK: 29528137
Oligozoospermia	MIK: 20096881
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 23540861

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23540861	Varicocele			40 (20 patients with varicocele (grade II), 20 age-matched healthy controls)	Male infertility	HSP 70 HSP 90
20096881	Oligozoospermia, varicocele			185 (117 patients with varicocele and 68 controls without varicocele)	Male infertility	HSPA4 HSF1 HSP90 and HSF2
23603921	Varicocele			26 (16 subfertile men diagnosed as VAR, 10 fertile men)	Male infertility
23540861	Varicocele, male infertility			40 (20 patients with varicocele (grade II), 20 age-matched healthy control subjects)	Male infertility
17880957	Male infertility			50 (37 infertile men, 13 fertile men (as controls))	Male infertility
20096881	Oligozoospermia, varicocele			185 (117 consecutive patients with varicocele, 68 controls without varicocele)	Male infertility	HSP90 HSPA4 HSF1 HSF2 and HSFY
20369545	Asthenozoospermia			6 seminal plasma samples were collected by Percoll respectively from healthy fertile and asthenozoospermia volunteers	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
21487003	Required for normal spermatogenesis				Male infertility
24899640	Essential for spermatogenesis				Male infertility	HSPBP1 BAG2 HSPA4
29528137	Nonobstructive azoospermia			21 (14 nonobstructive azoospermic men (N = 4; normal FSH and normal testicular volume and N = 10; high FSH and small testicular volume), seven normozoospermic men)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881