• Gene id: 3298

Gene Summary

• Gene Symbol: HSF2   Gene   UCSC   Ensembl
• Aliases: HSF 2, HSTF 2
• Gene name: heat shock transcription factor 2
• Alternate names: heat shock factor protein 2,
• Gene location: 6q22.31 (122399550: 122433118)     Exons: 13     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. Heat shock transcription factors activate heat-shock response genes under conditions
• OMIM: 140581

Protein Summary

• Protein general information: Q03933  
  • Name: Heat shock factor protein 2 (HSF 2) (Heat shock transcription factor 2) (HSTF 2)
  • Length: 536  
  • Mass: 60,348
• Sequence:

  MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVH
  IDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSEL
  KSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHH
  HKVPHSRTEGLKPRERISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQYPDIVIVEDDNEDEYAPVIQ
  SGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILNDNINLLGKVELLDYLDSIDCSLEDFQ
  AMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPL
  LAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPA
  PLDSDMPLLDS

• Structural information:
  • Interpro: IPR027712  IPR000232  IPR027725  IPR010542  IPR036388   IPR036390  
  • Prosite: PS00434
  • PDB: 5D8K 5D8L 5HDK
  • PDBsum: 5D8K 5D8L 5HDK
  • DIP: 56593
  • STRING: ENSP00000357440
• Other Databases: GeneCards:  HSF2  Malacards:  HSF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IEA	molecular function
GO:0001162	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IEA	molecular function
GO:0001162	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	IDA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001162	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process

Diseases

Associated diseases	References
Cleft defects	GAD: 18978678
Cleft defects	GAD: 18978678
Varicocele	MIK: 20096881
Oligozoospermia	MIK: 20096881
Male factor infertility	MIK: 23064888
Azoospermia	MIK: 23064888
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with male germ cell maturation	MIK: 20724452
Idiopathic azoospermia	MIK: 23064888
Involved in germ cell removal in cryptorchid testis	MIK: 21480429
Oligozoospermia	MIK: 20096881
Varicocele	MIK: 20096881
Role in spermatogenesis	MIK: 8080921
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20096881	Oligozoospermia, varicocele			185 (117 patients with varicocele and 68 controls without varicocele)	Male infertility	HSPA4 HSF1 HSP90 and HSF2
23064888	Idiopathic azoospermia	R502H		1287 (766 patients diagnosed with idiopathic azoospermia, 521 proven fertile men)	Male infertility
20096881	Oligozoospermia, varicocele			185 (117 consecutive patients with varicocele, 68 controls without varicocele)	Male infertility	HSP90 HSPA4 HSF1 HSF2 and HSFY
21480429	Involved in germ cell removal in cryptorchid testis				Male infertility
20724452	Assocaited with male germ cell maturation, spermatogenesis				Male infertility
9570917	Role in spermatogenesis				Male infertility
8080921	Role in spermatogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881