• Gene id: 327657

Gene Summary

• Gene Symbol: SERPINA9   Gene   UCSC   Ensembl
• Aliases: GCET1, SERPINA11, SERPINA11b
• Gene name: serpin family A member 9
• Alternate names: serpin A9, centerin, germinal center B-cell-expressed transcript 1 protein, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9, serine proteinase inhibitor A11, serpin peptidase inhibitor, clade A (alpha-1 antipr,
• Gene location: 14q32.13 (94476226: 94462720)     Exons: 6     NC_000014.9
• OMIM: 610561

Protein Summary

• Protein general information: Q86WD7  
  • Name: Serpin A9 (Centerin) (Germinal center B cell expressed transcript 1 protein)
  • Length: 417  
  • Mass: 46557
  • Tissue specificity: Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies. {ECO
• Sequence:

  MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSV
  STSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLG
  NVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNF
  PFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQK
  RWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFI
  VRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

• Structural information:
  • Interpro: IPR023795  IPR023796  IPR000215  IPR036186  IPR042178   IPR042185  
  • Prosite: PS00284
  • STRING: ENSP00000337133
• Other Databases: GeneCards:  SERPINA9  Malacards:  SERPINA9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray