Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 3276
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol PRMT1   Gene   UCSC   Ensembl
Aliases ANM1, HCP1, HRMT1L2, IR1B4
Gene name protein arginine methyltransferase 1
Alternate names protein arginine N-methyltransferase 1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2, heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2, histone-arginine N-methyltransferase PRMT1, interferon receptor 1-bound protein 4,
Gene location 19q13.33 (49676165: 49688449)     Exons: 13     NC_000019.10
Gene summary(Entrez) This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by
OMIM 102581

Protein Summary
Protein general information Q99873  

Name: Protein arginine N methyltransferase 1 (EC 2.1.1.319) (Histone arginine N methyltransferase PRMT1) (Interferon receptor 1 bound protein 4)

Length: 371  Mass: 42462

Tissue specificity: Widely expressed (PubMed

Sequence MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLT
YRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVE
LPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMS
CIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG
FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
Structural information
Protein Domains
 (50..36-)
PRMT-type (/note="SAM-dependent-MTase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
Interpro:  IPR025799  IPR041698  IPR029063  
Prosite:   PS51678

PDB:  		 6NT2
PDBsum:   6NT2

DIP:  
30878
MINT:  
STRING:   ENSP00000406162
Other Databases GeneCards:  PRMT1  Malacards:  PRMT1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IBA cellular component
GO:0043985 histone H4-R3 methylation
 IBA biological process
GO:0035241 protein-arginine omega-N
monomethyltransferase act
ivity
 IDA molecular function
GO:0045652 regulation of megakaryocy
te differentiation
 IDA biological process
GO:1904047 S-adenosyl-L-methionine b
inding
 IDA molecular function
GO:0044020 histone methyltransferase
activity (H4-R3 specific
)
 IDA molecular function
GO:0035242 protein-arginine omega-N
asymmetric methyltransfer
ase activity
 IDA molecular function
GO:0018216 peptidyl-arginine methyla
tion
 IDA biological process
GO:0042802 identical protein binding
 IDA molecular function
GO:0051260 protein homooligomerizati
on
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0034709 methylosome
 IDA cellular component
GO:0008327 methyl-CpG binding
 IDA molecular function
GO:0043985 histone H4-R3 methylation
 IDA biological process
GO:0008284 positive regulation of ce
ll population proliferati
on
 IMP biological process
GO:0006479 protein methylation
 IMP biological process
GO:0008276 protein methyltransferase
activity
 IMP molecular function
GO:0006479 protein methylation
 IMP biological process
GO:0044020 histone methyltransferase
activity (H4-R3 specific
)
 IMP molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0035242 protein-arginine omega-N
asymmetric methyltransfer
ase activity
 IMP molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0016274 protein-arginine N-methyl
transferase activity
 IEA molecular function
GO:0018216 peptidyl-arginine methyla
tion
 IEA biological process
GO:0032259 methylation
 IEA biological process
GO:0016740 transferase activity
 IEA molecular function
GO:0008168 methyltransferase activit
y
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0008168 methyltransferase activit
y
 TAS molecular function
GO:0008170 N-methyltransferase activ
ity
 TAS molecular function
GO:0005737 cytoplasm
 TAS cellular component
GO:0007166 cell surface receptor sig
naling pathway
 TAS biological process
GO:0006479 protein methylation
 TAS biological process
GO:0035242 protein-arginine omega-N
asymmetric methyltransfer
ase activity
 IEA molecular function
GO:0016274 protein-arginine N-methyl
transferase activity
 IDA molecular function
GO:0005634 nucleus
 IDA cellular component
GO:0016274 protein-arginine N-methyl
transferase activity
 EXP molecular function
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0016274 protein-arginine N-methyl
transferase activity
 TAS molecular function
GO:0045652 regulation of megakaryocy
te differentiation
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0016274 protein-arginine N-methyl
transferase activity
 IEA molecular function
GO:0008276 protein methyltransferase
activity
 IEA molecular function
GO:0042054 histone methyltransferase
activity
 IEA molecular function
GO:0001701 in utero embryonic develo
pment
 IEA biological process
GO:0048273 mitogen-activated protein
kinase p38 binding
 IPI molecular function
GO:0045648 positive regulation of er
ythrocyte differentiation
 IMP biological process
GO:0046985 positive regulation of he
moglobin biosynthetic pro
cess
 ISS biological process
GO:1900745 positive regulation of p3
8MAPK cascade
 ISS biological process
GO:0005654 nucleoplasm
 IEA cellular component
GO:0005829 cytosol
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0035247 peptidyl-arginine omega-N
-methylation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0019919 peptidyl-arginine methyla
tion, to asymmetrical-dim
ethyl arginine
 IEA biological process
GO:0019919 peptidyl-arginine methyla
tion, to asymmetrical-dim
ethyl arginine
 IEA biological process
GO:0019919 peptidyl-arginine methyla
tion, to asymmetrical-dim
ethyl arginine
 IEA biological process
GO:0016571 histone methylation
 IDA biological process
GO:0008170 N-methyltransferase activ
ity
 IDA molecular function
GO:0045653 negative regulation of me
gakaryocyte differentiati
on
 IDA biological process
GO:0042054 histone methyltransferase
activity
 IDA molecular function
GO:0018216 peptidyl-arginine methyla
tion
 IDA biological process
GO:0018216 peptidyl-arginine methyla
tion
 IDA biological process
GO:0008276 protein methyltransferase
activity
 IDA molecular function
GO:0008170 N-methyltransferase activ
ity
 IMP molecular function
GO:0031175 neuron projection develop
ment
 IMP biological process
GO:0003723 RNA binding
 HDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IBA cellular component
GO:0043985 histone H4-R3 methylation
 IBA biological process
GO:0035241 protein-arginine omega-N
monomethyltransferase act
ivity
 IDA molecular function
GO:0045652 regulation of megakaryocy
te differentiation
 IDA biological process
GO:1904047 S-adenosyl-L-methionine b
inding
 IDA molecular function
GO:0044020 histone methyltransferase
activity (H4-R3 specific
)
 IDA molecular function
GO:0035242 protein-arginine omega-N
asymmetric methyltransfer
ase activity
 IDA molecular function
GO:0018216 peptidyl-arginine methyla
tion
 IDA biological process
GO:0042802 identical protein binding
 IDA molecular function
GO:0051260 protein homooligomerizati
on
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0034709 methylosome
 IDA cellular component
GO:0008327 methyl-CpG binding
 IDA molecular function
GO:0043985 histone H4-R3 methylation
 IDA biological process
GO:0008284 positive regulation of ce
ll population proliferati
on
 IMP biological process
GO:0006479 protein methylation
 IMP biological process
GO:0008276 protein methyltransferase
activity
 IMP molecular function
GO:0006479 protein methylation
 IMP biological process
GO:0044020 histone methyltransferase
activity (H4-R3 specific
)
 IMP molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0035242 protein-arginine omega-N
asymmetric methyltransfer
ase activity
 IMP molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0016274 protein-arginine N-methyl
transferase activity
 IEA molecular function
GO:0018216 peptidyl-arginine methyla
tion
 IEA biological process
GO:0032259 methylation
 IEA biological process
GO:0016740 transferase activity
 IEA molecular function
GO:0008168 methyltransferase activit
y
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0008168 methyltransferase activit
y
 TAS molecular function
GO:0008170 N-methyltransferase activ
ity
 TAS molecular function
GO:0005737 cytoplasm
 TAS cellular component
GO:0007166 cell surface receptor sig
naling pathway
 TAS biological process
GO:0006479 protein methylation
 TAS biological process
GO:0035242 protein-arginine omega-N
asymmetric methyltransfer
ase activity
 IEA molecular function
GO:0016274 protein-arginine N-methyl
transferase activity
 IDA molecular function
GO:0005634 nucleus
 IDA cellular component
GO:0016274 protein-arginine N-methyl
transferase activity
 EXP molecular function
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological process
GO:0016274 protein-arginine N-methyl
transferase activity
 TAS molecular function
GO:0045652 regulation of megakaryocy
te differentiation
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0016274 protein-arginine N-methyl
transferase activity
 IEA molecular function
GO:0008276 protein methyltransferase
activity
 IEA molecular function
GO:0042054 histone methyltransferase
activity
 IEA molecular function
GO:0001701 in utero embryonic develo
pment
 IEA biological process
GO:0048273 mitogen-activated protein
kinase p38 binding
 IPI molecular function
GO:0045648 positive regulation of er
ythrocyte differentiation
 IMP biological process
GO:0046985 positive regulation of he
moglobin biosynthetic pro
cess
 ISS biological process
GO:1900745 positive regulation of p3
8MAPK cascade
 ISS biological process
GO:0005654 nucleoplasm
 IEA cellular component
GO:0005829 cytosol
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0035247 peptidyl-arginine omega-N
-methylation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0035246 peptidyl-arginine N-methy
lation
 IEA biological process
GO:0019919 peptidyl-arginine methyla
tion, to asymmetrical-dim
ethyl arginine
 IEA biological process
GO:0019919 peptidyl-arginine methyla
tion, to asymmetrical-dim
ethyl arginine
 IEA biological process
GO:0019919 peptidyl-arginine methyla
tion, to asymmetrical-dim
ethyl arginine
 IEA biological process
GO:0016571 histone methylation
 IDA biological process
GO:0008170 N-methyltransferase activ
ity
 IDA molecular function
GO:0045653 negative regulation of me
gakaryocyte differentiati
on
 IDA biological process
GO:0042054 histone methyltransferase
activity
 IDA molecular function
GO:0018216 peptidyl-arginine methyla
tion
 IDA biological process
GO:0018216 peptidyl-arginine methyla
tion
 IDA biological process
GO:0008276 protein methyltransferase
activity
 IDA molecular function
GO:0008170 N-methyltransferase activ
ity
 IMP molecular function
GO:0031175 neuron projection develop
ment
 IMP biological process
GO:0003723 RNA binding
 HDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0019899 enzyme binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04068FoxO signaling pathway
hsa04922Glucagon signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract