• Gene id: 3275

Gene Summary

• Gene Symbol: PRMT2   Gene   UCSC   Ensembl
• Aliases: HRMT1L1
• Gene name: protein arginine methyltransferase 2
• Alternate names: protein arginine N-methyltransferase 2, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, PRMT2 alpha, PRMT2 beta, PRMT2 gamma, histone-arginine N-methyltransferase PRMT2,
• Gene location: 21q22.3 (46635155: 46665684)     Exons: 13     NC_000021.9
• OMIM: 601961

Protein Summary

• Protein general information: P55345  
  • Name: Protein arginine N methyltransferase 2 (EC 2.1.1.319) (Histone arginine N methyltransferase PRMT2)
  • Length: 433  
  • Mass: 49042
  • Tissue specificity: Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord. {ECO
• Sequence:

  MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGC
  CGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI
  ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIES
  ILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL
  SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLF
  MMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

• Structural information:
  • Protein Domains: (30..8-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (99..43-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
  • Interpro: IPR025799  IPR029063  IPR036028  IPR001452  IPR007848  
  • Prosite: PS51678 PS50002
  • PDB: 1X2P
  • PDBsum: 1X2P
  • STRING: ENSP00000380759
• Other Databases: GeneCards:  PRMT2  Malacards:  PRMT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	ISS	biological process
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0042975	peroxisome proliferator activated receptor binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0016571	histone methylation	ISS	biological process
GO:0016274	protein-arginine N-methyltransferase activity	ISS	molecular function
GO:0008469	histone-arginine N-methyltransferase activity	ISS	molecular function
GO:0008469	histone-arginine N-methyltransferase activity	ISS	molecular function
GO:0048588	developmental cell growth	ISS	biological process
GO:0048588	developmental cell growth	ISS	biological process
GO:0046966	thyroid hormone receptor binding	IPI	molecular function
GO:0042974	retinoic acid receptor binding	IPI	molecular function
GO:0042974	retinoic acid receptor binding	IPI	molecular function
GO:0033142	progesterone receptor binding	IPI	molecular function
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0018216	peptidyl-arginine methylation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006479	protein methylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0034969	histone arginine methylation	IEA	biological process
GO:0034969	histone arginine methylation	IEA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016571	histone methylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0030331	estrogen receptor binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IGI	biological process
GO:0044877	protein-containing complex binding	ISS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq