• Gene id: 3274

Gene Summary

• Gene Symbol: HRH2   Gene   UCSC   Ensembl
• Aliases: H2R, HH2R
• Gene name: histamine receptor H2
• Alternate names: histamine H2 receptor, gastric receptor 1, gastric receptor I,
• Gene location: 5q35.2 (175657761: 175710755)     Exons: 8     NC_000005.10
• Gene summary(Entrez): Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. Histamine receptor H2 belongs to the family 1 of G protein-coupled
• OMIM: 602427

Protein Summary

• Protein general information: P25021  
  • Name: Histamine H2 receptor (H2R) (HH2R) (Gastric receptor I)
  • Length: 359  
  • Mass: 40098
• Sequence:

  MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSLAITDLLLGLLVLPFS
  AIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLVLIWVISITLS
  FLSIHLGWNSRNETSKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAA
  TIREHKATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
  QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000503  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000366506
• Other Databases: GeneCards:  HRH2  Malacards:  HRH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0001696	gastric acid secretion	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004969	histamine receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004969	histamine receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:1901998	toxin transport	IEA	biological process
GO:0048732	gland development	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0001698	gastrin-induced gastric acid secretion	IEA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0003382	epithelial cell morphogenesis	IEA	biological process
GO:0001697	histamine-induced gastric acid secretion	IEA	biological process
GO:0001696	gastric acid secretion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04971	Gastric acid secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq