• Gene id: 3273

Gene Summary

• Gene Symbol: HRG   Gene   UCSC   Ensembl
• Aliases: HPRG, HRGP, THPH11
• Gene name: histidine rich glycoprotein
• Alternate names: histidine-rich glycoprotein, histidine-proline-rich glycoprotein,
• Gene location: 3q27.3 (186665974: 186678234)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This histidine-rich glycoprotein contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions. The encoded protein a
• OMIM: 608726

SNPs

rs11754464

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31755958C>T
NC_000006.11   g.31723735C>T
NG_011611.1   g.20962C>T
NT_113891.3   g.3233215C>T
NT_113891.2   g.3233321C>T
NT_167245.2   g.3003732C>T
NT_167245.1   g.3009317C>T
NT_167247.2   g.3097847C>T
NT_167247.1   g.3103432C>T
NT_167248.2   g.3011780C>

Protein Summary

• Protein general information: P04196  
  • Name: Histidine rich glycoprotein (Histidine proline rich glycoprotein) (HPRG)
  • Length: 525  
  • Mass: 59578
  • Tissue specificity: Expressed in macrophages and in malignant cells. Expressed by the liver and secreted in plasma (at protein level). {ECO
• Sequence:

  MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDRVENTTVYYLVLDVQE
  SDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFED
  TERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGGEGTGYFVDFSVRNCPRHHFPRHPNVFGFCRADLFYD
  VEALDLESPKNLVINCEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP
  PDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQHPHGHHPHAHHPHEHD
  THRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPPPHNQGHCCHGHGPPPGHLRRRGPGKGPRPF
  HCRQIGSVYRLPPLRKGEVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK

• Structural information:
  • Protein Domains: (19..13-)
    (/note="Cystatin-1)
    (137..25-)
    (/note="Cystatin-2")
  • Interpro: IPR000010  
  • CDD: cd00042
  • DIP: 47264
  • STRING: ENSP00000232003
• Other Databases: GeneCards:  HRG  Malacards:  HRG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004866	endopeptidase inhibitor activity	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0008270	zinc ion binding	IBA	molecular function
GO:0010543	regulation of platelet activation	IBA	biological process
GO:0015886	heme transport	IBA	biological process
GO:0036019	endolysosome	IBA	cellular component
GO:0051918	negative regulation of fibrinolysis	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0008201	heparin binding	IBA	molecular function
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:2001027	negative regulation of endothelial cell chemotaxis	IDA	biological process
GO:2001027	negative regulation of endothelial cell chemotaxis	IDA	biological process
GO:2001027	negative regulation of endothelial cell chemotaxis	IDA	biological process
GO:0043254	regulation of protein-containing complex assembly	IDA	biological process
GO:0033629	negative regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:2000504	positive regulation of blood vessel remodeling	IDA	biological process
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0043395	heparan sulfate proteoglycan binding	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IDA	biological process
GO:0010593	negative regulation of lamellipodium assembly	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0007162	negative regulation of cell adhesion	IDA	biological process
GO:0002839	positive regulation of immune response to tumor cell	IDA	biological process
GO:0010543	regulation of platelet activation	ISS	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0007596	blood coagulation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007599	hemostasis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042730	fibrinolysis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0042730	fibrinolysis	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030168	platelet activation	IDA	biological process
GO:0020037	heme binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0030193	regulation of blood coagulation	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0050832	defense response to fungus	IDA	biological process
GO:0046872	metal ion binding	IDA	molecular function
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0043395	heparan sulfate proteoglycan binding	IDA	molecular function
GO:0030193	regulation of blood coagulation	IDA	biological process
GO:0019865	immunoglobulin binding	IDA	molecular function
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0050832	defense response to fungus	IDA	biological process
GO:0050832	defense response to fungus	IDA	biological process
GO:0050832	defense response to fungus	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component

Diseases

Associated diseases	References
Inherited thrombophilia	KEGG:H00223
Inherited thrombophilia	KEGG:H00223
Thrombosis	PMID:9414276
pancreatic adenocarcinoma	PMID:21713765
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881