• Gene id: 3269

Gene Summary

• Gene Symbol: HRH1   Gene   UCSC   Ensembl
• Aliases: H1-R, H1R, HH1R, hisH1
• Gene name: histamine receptor H1
• Alternate names: histamine H1 receptor, histamine receptor, subclass H1,
• Gene location: 3p25.3 (57119653: 57131982)     Exons: 5     NC_000019.10
• Gene summary(Entrez): Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. The protein encoded by this gene is an integral membrane protein an
• OMIM: 600167

Protein Summary

• Protein general information: P35367  
  • Name: Histamine H1 receptor (H1R) (HH1R)
  • Length: 487  
  • Mass: 55784
• Sequence:

  MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLI
  VGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILG
  AWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRE
  LINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
  YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGK
  LRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNEHLH
  MFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000921  
  • Prosite: PS00237 PS50262
  • PDB: 3RZE
  • PDBsum: 3RZE
  • DIP: 41996
  • STRING: ENSP00000380247
• Other Databases: GeneCards:  HRH1  Malacards:  HRH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0071420	cellular response to histamine	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0004969	histamine receptor activity	ISS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0043114	regulation of vascular permeability	IEA	biological process
GO:0048245	eosinophil chemotaxis	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004969	histamine receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0004969	histamine receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007613	memory	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0004969	histamine receptor activity	ISS	molecular function
GO:0071420	cellular response to histamine	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0032962	positive regulation of inositol trisphosphate biosynthetic process	ISS	biological process
GO:0048016	inositol phosphate-mediated signaling	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0098664	G protein-coupled serotonin receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq