• Gene id: 3268

Gene Summary

• Gene Symbol: AGFG2   Gene   UCSC   Ensembl
• Aliases: HRBL, RABR
• Gene name: ArfGAP with FG repeats 2
• Alternate names: arf-GAP domain and FG repeat-containing protein 2, HIV-1 Rev-binding protein-like protein, Rev/Rex activation domain binding protein-related, arf-GAP domain and FG repeats-containing protein 2, nucleoporin, rev/Rex activation domain-binding protein related,
• Gene location: 7q22.1 (100539202: 100568219)     Exons: 14     NC_000007.14
• Gene summary(Entrez): This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and play
• OMIM: 615246

Protein Summary

• Protein general information: O95081  
  • Name: Arf GAP domain and FG repeat containing protein 2 (HIV 1 Rev binding protein like protein) (Rev/Rex activation domain binding protein related) (RAB R)
  • Length: 481  
  • Mass: 48963
• Sequence:

  MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLR
  GLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQ
  VKGPTYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDL
  LADIGGDPFAAPQMAPAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPAGQASFQAQPTPAGSSQGTPF
  GATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMGGGGGSSTGLAFGAFTNPFTAPAAQS
  PLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLVQQQNGSSFGDLGSAKLGQRPL
  SQPAGISTNPFMTGPSSSPFASKPPTTNPFL

• Structural information:
  • Protein Domains: (27..15-)
    (/note="Arf-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00288"-)
  • Interpro: IPR037278  IPR001164  IPR038508  
  • Prosite: PS50115
  • STRING: ENSP00000300176
• Other Databases: GeneCards:  AGFG2  Malacards:  AGFG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881