• Gene id: 3250

Gene Summary

• Gene Symbol: HPR   Gene   UCSC   Ensembl
• Aliases: A-259H10.2, HP
• Gene name: haptoglobin-related protein
• Alternate names: haptoglobin-related protein, Haptoglobin-related locus,
• Gene location: 16q22.2 (72063225: 72077245)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesti
• OMIM: 607410

Protein Summary

• Protein general information: P00739  
  • Name: Haptoglobin related protein
  • Length: 348  
  • Mass: 39030
  • Tissue specificity: In adult liver the amount of HPR mRNA is at the lower limit of detection, therefore the extent of its expression is at most less than 1000-fold that of the HP1F gene. No HPR mRNA can be detected in fetal liver. Expressed in Hep-G2 and
• Sequence:

  MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQW
  INKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNH
  SENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSG
  WGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSA
  FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN

• Structural information:
  • Protein Domains: (34..8-)
    (/note="Sushi-)
    (104..34-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR008292  IPR009003  IPR001314  IPR035976  IPR001254  
  • Prosite: PS50240
  • CDD: cd00190
  • STRING: ENSP00000441828
• Other Databases: GeneCards:  HPR  Malacards:  HPR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0002526	acute inflammatory response	IBA	biological process
GO:0010942	positive regulation of cell death	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030492	hemoglobin binding	IEA	molecular function
GO:0030492	hemoglobin binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0034366	spherical high-density lipoprotein particle	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030492	hemoglobin binding	NAS	molecular function
GO:0072562	blood microparticle	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881