• Gene id: 325

Gene Summary

• Gene Symbol: APCS   Gene   UCSC   Ensembl
• Aliases: HEL-S-92n, PTX2, SAP
• Gene name: amyloid P component, serum
• Alternate names: serum amyloid P-component, 9.5S alpha-1-glycoprotein, epididymis secretory sperm binding protein Li 92n, pentaxin-related, pentraxin-2, pentraxin-related,
• Gene location: 1q23.2 (159587825: 159588864)     Exons: 2     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene dupli
• OMIM: 142705

Protein Summary

• Protein general information: P02743  
  • Name: Serum amyloid P component (SAP) (9.5S alpha 1 glycoprotein) [Cleaved into: Serum amyloid P component(1 203)]
  • Length: 223  
  • Mass: 25387
  • Tissue specificity: Found in serum and urine. {ECO
• Sequence:

  MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQG
  RDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKI
  VLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV

• Structural information:
  • Protein Domains: (24..22-)
    (/note="Pentraxin-(PTX))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01172"-)
  • Interpro: IPR013320  IPR030476  IPR001759  
  • Prosite: PS00289 PS51828
  • CDD: cd00152
  • PDB: 1GYK 1LGN 1SAC 2A3W 2A3X 2A3Y 2W08 3D5O 3KQR 4AVS 4AVT 4AVV 4AYU
  • PDBsum: 1GYK 1LGN 1SAC 2A3W 2A3X 2A3Y 2W08 3D5O 3KQR 4AVS 4AVT 4AVV 4AYU
  • DIP: 46911
  • STRING: ENSP00000255040
• Other Databases: GeneCards:  APCS  Malacards:  APCS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045087	innate immune response	IBA	biological process
GO:0044793	negative regulation by host of viral process	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0001849	complement component C1q complex binding	IBA	molecular function
GO:0030169	low-density lipoprotein particle binding	IBA	molecular function
GO:0006958	complement activation, classical pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0006953	acute-phase response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0051131	chaperone-mediated protein complex assembly	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001849	complement component C1q complex binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0046790	virion binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0045087	innate immune response	IDA	biological process
GO:0045656	negative regulation of monocyte differentiation	IDA	biological process
GO:0002674	negative regulation of acute inflammatory response	IC	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0048525	negative regulation of viral process	IDA	biological process
GO:0061045	negative regulation of wound healing	IC	biological process
GO:1903016	negative regulation of exo-alpha-sialidase activity	IDA	biological process
GO:1903019	negative regulation of glycoprotein metabolic process	IDA	biological process
GO:0044869	negative regulation by host of viral exo-alpha-sialidase activity	IDA	biological process
GO:0044871	negative regulation by host of viral glycoprotein metabolic process	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005576	extracellular region	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Amyloidosis	PMID:12015594
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881