• Gene id: 3248

Gene Summary

• Gene Symbol: HPGD   Gene   UCSC   Ensembl
• Aliases: 15-PGDH, PGDH, PGDH1, PHOAR1, SDR36C1
• Gene name: 15-hydroxyprostaglandin dehydrogenase
• Alternate names: 15-hydroxyprostaglandin dehydrogenase [NAD(+)], 15-hydroxyprostaglandin dehydrogenase (NAD(+)), NAD+-dependent 15-hydroxyprostaglandin dehydrogenase, hydroxyprostaglandin dehydrogenase 15-(NAD), prostaglandin dehydrogenase 1, short chain dehydrogenase/reductas,
• Gene location: 4q34.1 (174522897: 174490174)     Exons: 10     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflamma
• OMIM: 601688

Protein Summary

• Protein general information: P15428  
  • Name: 15 hydroxyprostaglandin dehydrogenase [NAD(+)] (15 PGDH) (EC 1.1.1.141) (Prostaglandin dehydrogenase 1) (Short chain dehydrogenase/reductase family 36C member 1)
  • Length: 266  
  • Mass: 28977
  • Tissue specificity: Detected in colon epithelium (at protein level). {ECO
• Sequence:

  MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTF
  RKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
  YCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLI
  ANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • PDB: 2GDZ
  • PDBsum: 2GDZ
  • STRING: ENSP00000296522
• Other Databases: GeneCards:  HPGD  Malacards:  HPGD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IBA	molecular function
GO:0007565	female pregnancy	IBA	biological process
GO:0006693	prostaglandin metabolic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IDA	molecular function
GO:0006693	prostaglandin metabolic process	IDA	biological process
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IDA	molecular function
GO:0070403	NAD+ binding	IDA	molecular function
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IMP	molecular function
GO:1905828	regulation of prostaglandin catabolic process	IMP	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:2001301	lipoxin biosynthetic process	TAS	biological process
GO:0001822	kidney development	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IEA	molecular function
GO:0032355	response to estradiol	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IEA	molecular function
GO:0097070	ductus arteriosus closure	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IDA	molecular function
GO:0007567	parturition	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0006693	prostaglandin metabolic process	IDA	biological process
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IDA	molecular function
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IDA	molecular function
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IDA	molecular function
GO:0007565	female pregnancy	IDA	biological process
GO:0004957	prostaglandin E receptor activity	IDA	molecular function
GO:0070403	NAD+ binding	IDA	molecular function
GO:0051287	NAD binding	IDA	molecular function
GO:0051287	NAD binding	IDA	molecular function
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	NAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0097070	ductus arteriosus closure	ISS	biological process
GO:0030728	ovulation	ISS	biological process
GO:0019372	lipoxygenase pathway	TAS	biological process
GO:0005829	cytosol	NAS	cellular component
GO:0070493	thrombin-activated receptor signaling pathway	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Primary hypertrophic osteoarthropathy	KEGG:H00457
Isolated congenital nail clubbing	KEGG:H01246
Primary hypertrophic osteoarthropathy	KEGG:H00457
Isolated congenital nail clubbing	KEGG:H01246
Inflammatory bowel disease	PMID:16195422
Colon carcinoma	PMID:19494278
Prolactinoma	PMID:22580984
growth hormone secreting pituitary adenoma	PMID:22580984
Pulmonary hypertension	PMID:24657469
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)