• Gene id: 3237

Gene Summary

• Gene Symbol: HOXD11   Gene   UCSC   Ensembl
• Aliases: HOX4, HOX4F
• Gene name: homeobox D11
• Alternate names: homeobox protein Hox-D11, Hox-4.6, mouse, homolog of, homeo box 4F, homeo box D11, homeobox protein Hox-4F,
• Gene location: 2q31.1 (176107279: 176109753)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
• OMIM: 142986

Protein Summary

• Protein general information: P31277  
  • Name: Homeobox protein Hox D11 (Homeobox protein Hox 4F)
  • Length: 338  
  • Mass: 35197
• Sequence:

  MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPY
  RGGGGGGSAGGGSSGGGPGGGGGGAGGYAPYYAAAAAAAAAAAAAEEAAMQRELLPPAGRRPDVLFKAPEPVCAA
  PGPPHGPAGAASNFYSAVGRNGILPQGFDQFYEAAPGPPFAGPQPPPPPAPPQPEGAADKGDPRTGAGGGGGSPC
  TKATPGSEPKGAAEGSGGDGEGPPGEAGAEKSSSAVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLS
  RMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF

• Structural information:
  • Interpro: IPR021918  IPR009057  IPR017970  IPR001356  IPR020479  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000249504
• Other Databases: GeneCards:  HOXD11  Malacards:  HOXD11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0009953	dorsal/ventral pattern formation	ISS	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 22906644
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
22906644	Hypospadias	Methylation site (cg01708273)		20 (12 patients with isolated hypospadias and 8 healthy controls)	Male infertility	Microarray