• Gene id: 3236

Gene Summary

• Gene Symbol: HOXD10   Gene   UCSC   Ensembl
• Aliases: HOX4, HOX4D, HOX4E, Hox-4.4
• Gene name: homeobox D10
• Alternate names: homeobox protein Hox-D10, homeo box 4D, homeo box D10, homeobox protein Hox-4D, homeobox protein Hox-4E,
• Gene location: 2q31.1 (176116777: 176119936)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcriptio
• OMIM: 142984

Protein Summary

• Protein general information: P28358  
  • Name: Homeobox protein Hox D10 (Homeobox protein Hox 4D) (Homeobox protein Hox 4E)
  • Length: 340  
  • Mass: 38411
  • Tissue specificity: Strongly expressed in the adult male and female urogenital tracts.
• Sequence:

  MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYI
  PQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPG
  YFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGL
  PEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
  KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000249501
• Other Databases: GeneCards:  HOXD10  Malacards:  HOXD10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050905	neuromuscular process	IEA	biological process
GO:0035137	hindlimb morphogenesis	IEA	biological process
GO:0035136	forelimb morphogenesis	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0021520	spinal cord motor neuron cell fate specification	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0001501	skeletal system development	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0048935	peripheral nervous system neuron development	IEA	biological process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer

Diseases

Associated diseases	References
Congenital vertical talus	KEGG:H00929
Congenital vertical talus	KEGG:H00929
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)