• Gene id: 3226

Gene Summary

• Gene Symbol: HOXC10   Gene   UCSC   Ensembl
• Aliases: HOX3I
• Gene name: homeobox C10
• Alternate names: homeobox protein Hox-C10, homeo box C10, homeobox protein Hox-3I, homeoprotein C10,
• Gene location: 12q13.13 (53985145: 53990278)     Exons: 2     NC_000012.12
• Gene summary(Entrez): This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
• OMIM: 605560

Protein Summary

• Protein general information: Q9NYD6  
  • Name: Homeobox protein Hox C10 (Homeobox protein Hox 3I)
  • Length: 342  
  • Mass: 38073
• Sequence:

  MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQ
  LDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYR
  ASPSYSALDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKG
  SPSESEKERAKAADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLE
  ISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000307321
• Other Databases: GeneCards:  HOXC10  Malacards:  HOXC10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050905	neuromuscular process	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0021520	spinal cord motor neuron cell fate specification	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)