• Gene id: 322

Gene Summary

• Gene Symbol: APBB1   Gene   UCSC   Ensembl
• Aliases: FE65, MGC:9072, RIR
• Gene name: amyloid beta precursor protein binding family B member 1
• Alternate names: amyloid-beta A4 precursor protein-binding family B member 1, adaptor protein FE65a2, amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65), stat-like protein,
• Gene location: 11p15.4 (6419452: 6395123)     Exons: 19     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density li
• OMIM: 614232

Protein Summary

• Protein general information: O00213  
  • Name: Amyloid beta A4 precursor protein binding family B member 1 (Protein Fe65)
  • Length: 710  
  • Mass: 77244
  • Tissue specificity: Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease. {ECO
• Sequence:

  MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQN
  QLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIISTQEQGPDEGE
  EKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWA
  TLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
  TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGIKCFAVRSL
  GWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQALLHAQPIISI
  RVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVD
  VPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV
  LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPA
  PPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP

• Structural information:
  • Protein Domains: (253..28-)
    (/note="WW-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (370..50-)
    (/note="PID-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148-)
    (542..69-)
    (/note="PID-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00148"-)
  • Interpro: IPR039576  IPR011993  IPR006020  IPR001202  IPR036020  
  • Prosite: PS01179 PS01159 PS50020
  • CDD: cd00201
  • PDB: 2E45 2HO2 2IDH 2OEI 3D8D 3D8E 3D8F 3DXC 3DXD 3DXE 5NQH
  • PDBsum: 2E45 2HO2 2IDH 2OEI 3D8D 3D8E 3D8F 3DXC 3DXD 3DXE 5NQH
  • DIP: 30903
  • STRING: ENSP00000477213
• Other Databases: GeneCards:  APBB1  Malacards:  APBB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IGI	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0001540	amyloid-beta binding	IBA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070064	proline-rich region binding	IPI	molecular function
GO:0043967	histone H4 acetylation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0042393	histone binding	IPI	molecular function
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0044304	main axon	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048156	tau protein binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:1990761	growth cone lamellipodium	IEA	cellular component
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006302	double-strand break repair	IEA	biological process
GO:0010039	response to iron ion	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043967	histone H4 acetylation	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045739	positive regulation of DNA repair	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0050714	positive regulation of protein secretion	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:1990812	growth cone filopodium	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045202	synapse	IDA	cellular component
GO:0030426	growth cone	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0007409	axonogenesis	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050760	negative regulation of thymidylate synthase biosynthetic process	ISS	biological process
GO:0008134	transcription factor binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0001540	amyloid-beta binding	NAS	molecular function
GO:0030308	negative regulation of cell growth	ISS	biological process
GO:0007050	cell cycle arrest	ISS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0001540	amyloid-beta binding	ISS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease

Diseases

Associated diseases	References
Alzheimer's disease	PMID:10723070
Alzheimer's disease	PMID:9799084
Alzheimer's disease	PMID:12727304
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq