About Us

Search Result


Gene id 3218
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol HOXB8   Gene   UCSC   Ensembl
Aliases HOX2, HOX2D, Hox-2.4
Gene name homeobox B8
Alternate names homeobox protein Hox-B8, homeo box 2D, homeo box B8, homeobox protein Hox-2.4, homeobox protein Hox-2D,
Gene location 17q21.32 (48619530: 48612345)     Exons: 5     NC_000017.11
Gene summary(Entrez) This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio

Protein Summary

Protein general information P17481  

Name: Homeobox protein Hox B8 (Homeobox protein Hox 2.4) (Homeobox protein Hox 2D)

Length: 243  Mass: 27574

Sequence MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCA
VACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGR
QTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKL
ERAPEAADEGDAQKGDKK
Structural information
Interpro:  IPR009057  IPR001827  IPR017970  IPR001356  IPR020479  
IPR000047  
Prosite:   PS00032 PS00027 PS50071
CDD:   cd00086
STRING:   ENSP00000239144
Other Databases GeneCards:  HOXB8  Malacards:  HOXB8

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISM molecular function
GO:0000790 nuclear chromatin
ISA cellular component
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISA molecular function
GO:0045638 negative regulation of my
eloid cell differentiatio
n
ISS biological process
GO:0003700 DNA-binding transcription
factor activity
IEA molecular function
GO:0043565 sequence-specific DNA bin
ding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0048705 skeletal system morphogen
esis
IEA biological process
GO:0043565 sequence-specific DNA bin
ding
IEA molecular function
GO:0021516 dorsal spinal cord develo
pment
IEA biological process
GO:0009952 anterior/posterior patter
n specification
IEA biological process
GO:0008344 adult locomotory behavior
IEA biological process
GO:0048704 embryonic skeletal system
morphogenesis
IEA biological process
GO:0045638 negative regulation of my
eloid cell differentiatio
n
IEA biological process
GO:0019233 sensory perception of pai
n
IEA biological process
GO:0007625 grooming behavior
IEA biological process
GO:0001227 DNA-binding transcription
repressor activity, RNA
polymerase II-specific
IEA molecular function
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract