About Us

Search Result


Gene id 3215
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol HOXB5   Gene   UCSC   Ensembl
Aliases HHO.C10, HOX2, HOX2A, HU-1, Hox2.1
Gene name homeobox B5
Alternate names homeobox protein Hox-B5, homeo box 2A, homeo box B5, homeobox protein HHO.C10, homeobox protein Hox-2A, homeobox protein Hu-1,
Gene location 17q21.32 (47967903: 47981785)     Exons: 16     NC_000017.11
Gene summary(Entrez) This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio
OMIM 142960

Protein Summary

Protein general information P09067  

Name: Homeobox protein Hox B5 (Homeobox protein HHO.C10) (Homeobox protein Hox 2A) (Homeobox protein Hu 1)

Length: 269  Mass: 29434

Tissue specificity: Spinal cord.

Sequence MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRA
FPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEEAASQLS
SPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRI
EIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP
Structural information
Interpro:  IPR009057  IPR017995  IPR001827  IPR017970  IPR001356  
IPR020479  
Prosite:   PS00032 PS00027 PS50071
CDD:   cd00086
STRING:   ENSP00000239151
Other Databases GeneCards:  HOXB5  Malacards:  HOXB5

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISM molecular function
GO:0000790 nuclear chromatin
ISA cellular component
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
ISA molecular function
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
IBA molecular function
GO:0009952 anterior/posterior patter
n specification
IBA biological process
GO:0000981 DNA-binding transcription
factor activity, RNA pol
ymerase II-specific
IBA molecular function
GO:0005634 nucleus
IBA cellular component
GO:0003700 DNA-binding transcription
factor activity
IEA molecular function
GO:0043565 sequence-specific DNA bin
ding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0009653 anatomical structure morp
hogenesis
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0048706 embryonic skeletal system
development
IEA biological process
GO:0009952 anterior/posterior patter
n specification
IEA biological process
GO:0003700 DNA-binding transcription
factor activity
IEA molecular function
GO:0001228 DNA-binding transcription
activator activity, RNA
polymerase II-specific
IEA molecular function
GO:0000978 RNA polymerase II cis-reg
ulatory region sequence-s
pecific DNA binding
IEA molecular function
GO:0048704 embryonic skeletal system
morphogenesis
IEA biological process
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
IEA biological process
GO:0045446 endothelial cell differen
tiation
IEA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0001650 fibrillar center
IDA cellular component
GO:0005829 cytosol
IDA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract