• Gene id: 3214

Gene Summary

• Gene Symbol: HOXB4   Gene   UCSC   Ensembl
• Aliases: HOX-2.6, HOX2, HOX2F
• Gene name: homeobox B4
• Alternate names: homeobox protein Hox-B4, homeo box 2F, homeo box B4, homeobox protein Hox-2.6, homeobox protein Hox-2F,
• Gene location: 17q21.32 (48578349: 48575506)     Exons: 2     NC_000017.11
• Gene summary(Entrez): This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio
• OMIM: 609882

Protein Summary

• Protein general information: P17483  
  • Name: Homeobox protein Hox B4 (Homeobox protein Hox 2.6) (Homeobox protein Hox 2F)
  • Length: 251  
  • Mass: 27604
• Sequence:

  MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRDPGPPP
  PPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHV
  STVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPN
  TKIRSGGAAGSAGGPPGRPNGGPRAL

• Structural information:
  • Interpro: IPR009057  IPR017995  IPR001827  IPR017970  IPR001356   IPR020479  
  • Prosite: PS00032 PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000328928
• Other Databases: GeneCards:  HOXB4  Malacards:  HOXB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0009952	anterior/posterior pattern specification	IBA	biological process
GO:0001501	skeletal system development	IBA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0048704	embryonic skeletal system morphogenesis	IBA	biological process
GO:0033613	activating transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0002011	morphogenesis of an epithelial sheet	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0048539	bone marrow development	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0060216	definitive hemopoiesis	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0048103	somatic stem cell division	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0060218	hematopoietic stem cell differentiation	IDA	biological process
GO:2000738	positive regulation of stem cell differentiation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0009952	anterior/posterior pattern specification	IBA	biological process
GO:0001501	skeletal system development	IBA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0048704	embryonic skeletal system morphogenesis	IBA	biological process
GO:0033613	activating transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0002011	morphogenesis of an epithelial sheet	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0048539	bone marrow development	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0060216	definitive hemopoiesis	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0030097	hemopoiesis	IEA	biological process
GO:0048103	somatic stem cell division	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0060218	hematopoietic stem cell differentiation	IDA	biological process
GO:2000738	positive regulation of stem cell differentiation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881