• Gene id: 3205

Gene Summary

• Gene Symbol: HOXA9   Gene   UCSC   Ensembl
• Aliases: ABD-B, HOX1, HOX1.7, HOX1G
• Gene name: homeobox A9
• Alternate names: homeobox protein Hox-A9, homeobox protein Hox-1G, homeodomain protein HOXA9,
• Gene location: 7p15.2 (27165536: 27162437)     Exons: 2     NC_000007.14
• Gene summary(Entrez): In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo
• OMIM: 604139

Protein Summary

• Protein general information: P31269  
  • Name: Homeobox protein Hox A9 (Homeobox protein Hox 1G)
  • Length: 272  
  • Mass: 30172
• Sequence:

  MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPVHAAGA
  NAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTH
  TLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEF
  LFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  IPR006711   IPR017112  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000343619
• Other Databases: GeneCards:  HOXA9  Malacards:  HOXA9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0009952	anterior/posterior pattern specification	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0048704	embryonic skeletal system morphogenesis	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0009954	proximal/distal pattern formation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045638	negative regulation of myeloid cell differentiation	ISS	biological process
GO:0042118	endothelial cell activation	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0007338	single fertilization	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0048706	embryonic skeletal system development	IEA	biological process
GO:0060216	definitive hemopoiesis	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0008584	male gonad development	IEA	biological process
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0035115	embryonic forelimb morphogenesis	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060065	uterus development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R