• Gene id: 3192

Gene Summary

• Gene Symbol: HNRNPU   Gene   UCSC   Ensembl
• Aliases: EIEE54, GRIP120, HNRNPU-AS1, HNRPU, SAF-A, SAFA, U21.1, hnRNP U, pp120
• Gene name: heterogeneous nuclear ribonucleoprotein U
• Alternate names: heterogeneous nuclear ribonucleoprotein U, HNRNPU antisense RNA 1, heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A), nuclear p120 ribonucleoprotein, p120 nuclear protein,
• Gene location: 1q44 (244864542: 244850296)     Exons: 14     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of a family of proteins that bind nucleic acids and function in the formation of ribonucleoprotein complexes in the nucleus with heterogeneous nuclear RNA (hnRNA). The encoded protein has affinity for both RNA and DNA, and binds
• OMIM: 602869

Protein Summary

• Protein general information: Q00839  
  • Name: Heterogeneous nuclear ribonucleoprotein U (hnRNP U) (GRIP120) (Nuclear p120 ribonucleoprotein) (Scaffold attachment factor A) (SAF A) (p120) (pp120)
  • Length: 825  
  • Mass: 90584
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRSGAGLE
  QEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEE
  GAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRP
  GAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK
  ISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEE
  EFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVLAGRPLFPHVLC
  HNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKY
  NILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQ
  RKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKK
  ALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIG
  YPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

• Structural information:
  • Protein Domains: (8..4-)
    (/note="SAP-)
    ECO:0000269|PubMed:9405365 (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186,-ECO:0000269|PubMed:11003645,)
    (267..46-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR013320  IPR026745  IPR027417  IPR003034   IPR036361  IPR003877  IPR035778  
  • Prosite: PS50188 PS50800
  • CDD: cd12884
  • PDB: 1ZRJ
  • PDBsum: 1ZRJ
  • DIP: 684
  • STRING: ENSP00000283179
• Other Databases: GeneCards:  HNRNPU  Malacards:  HNRNPU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1990841	promoter-specific chromatin binding	IBA	molecular function
GO:1990023	mitotic spindle midzone	IBA	cellular component
GO:1901673	regulation of mitotic spindle assembly	IBA	biological process
GO:0099122	RNA polymerase II C-terminal domain binding	IBA	molecular function
GO:0098577	inactive sex chromosome	IBA	cellular component
GO:0090575	RNA polymerase II transcription regulator complex	IBA	colocalizes with
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0070937	CRD-mediated mRNA stability complex	IBA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IBA	cellular component
GO:0036002	pre-mRNA binding	IBA	molecular function
GO:0034046	poly(G) binding	IBA	molecular function
GO:0016363	nuclear matrix	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0005697	telomerase holoenzyme complex	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0001097	TFIIH-class transcription factor complex binding	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000776	kinetochore	IBA	cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:1990498	mitotic spindle microtubule	IBA	cellular component
GO:1990280	RNA localization to chromatin	IBA	biological process
GO:1902425	positive regulation of attachment of mitotic spindle microtubules to kinetochore	IBA	biological process
GO:1902275	regulation of chromatin organization	IBA	biological process
GO:0070934	CRD-mediated mRNA stabilization	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0043021	ribonucleoprotein complex binding	IBA	molecular function
GO:0032211	negative regulation of telomere maintenance via telomerase	IBA	biological process
GO:0017130	poly(C) RNA binding	IBA	molecular function
GO:0017069	snRNA binding	IBA	molecular function
GO:0016607	nuclear speck	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0000228	nuclear chromosome	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001097	TFIIH-class transcription factor complex binding	IDA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IDA	colocalizes with
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0036002	pre-mRNA binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0000776	kinetochore	IDA	cellular component
GO:1990023	mitotic spindle midzone	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0034046	poly(G) binding	IDA	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0098577	inactive sex chromosome	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0048255	mRNA stabilization	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0071385	cellular response to glucocorticoid stimulus	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0017069	snRNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:1990837	sequence-specific double-stranded DNA binding	IDA	molecular function
GO:0000228	nuclear chromosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1990837	sequence-specific double-stranded DNA binding	IDA	molecular function
GO:0031490	chromatin DNA binding	IDA	molecular function
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0042802	identical protein binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:1990498	mitotic spindle microtubule	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0017130	poly(C) RNA binding	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0043021	ribonucleoprotein complex binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0034244	negative regulation of transcription elongation from RNA polymerase II promoter	IMP	biological process
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0009048	dosage compensation by inactivation of X chromosome	ISS	biological process
GO:1990841	promoter-specific chromatin binding	ISS	molecular function
GO:0099122	RNA polymerase II C-terminal domain binding	ISS	molecular function
GO:2000737	negative regulation of stem cell differentiation	ISS	biological process
GO:2000737	negative regulation of stem cell differentiation	IMP	biological process
GO:0051457	maintenance of protein location in nucleus	IMP	biological process
GO:1990845	adaptive thermogenesis	ISS	biological process
GO:0090336	positive regulation of brown fat cell differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0033673	negative regulation of kinase activity	IMP	biological process
GO:1902275	regulation of chromatin organization	IMP	biological process
GO:1902889	protein localization to spindle microtubule	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000648	positive regulation of stem cell proliferation	ISS	biological process
GO:1990280	RNA localization to chromatin	ISS	biological process
GO:1902425	positive regulation of attachment of mitotic spindle microtubules to kinetochore	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007346	regulation of mitotic cell cycle	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	ISS	biological process
GO:2000373	positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity	ISS	biological process
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0006396	RNA processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0016070	RNA metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0009048	dosage compensation by inactivation of X chromosome	IEA	biological process
GO:0016071	mRNA metabolic process	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0055013	cardiac muscle cell development	IEA	biological process
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:0098577	inactive sex chromosome	IEA	cellular component
GO:0099122	RNA polymerase II C-terminal domain binding	IEA	molecular function
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:1990845	adaptive thermogenesis	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:2000737	negative regulation of stem cell differentiation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0098963	dendritic transport of messenger ribonucleoprotein complex	IEA	biological process
GO:1990280	RNA localization to chromatin	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:2000648	positive regulation of stem cell proliferation	IEA	biological process
GO:0070034	telomerase RNA binding	IPI	molecular function
GO:0005697	telomerase holoenzyme complex	IDA	cellular component
GO:0032211	negative regulation of telomere maintenance via telomerase	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IPI	molecular function
GO:0016363	nuclear matrix	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0070937	CRD-mediated mRNA stability complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070934	CRD-mediated mRNA stabilization	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Early infantile epileptic encephalopathy	KEGG:H00606
Early infantile epileptic encephalopathy	KEGG:H00606
colorectal cancer	PMID:21194727
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R