• Gene id: 319100

Gene Summary

• Gene Symbol: TAAR6   Gene   UCSC   Ensembl
• Aliases: TA4, TAR4, TAR6, TRAR4, taR-4, taR-6
• Gene name: trace amine associated receptor 6
• Alternate names: trace amine-associated receptor 6, trace amine receptor 4, trace amine receptor 6,
• Gene location: 6q23.2 (152984080: 152985813)     Exons: 2     NC_000001.11
• Gene summary(Entrez): This gene encodes a seven-transmembrane G-protein-coupled receptor that likely functions as a receptor for endogenous trace amines. Mutations in this gene may be associated with schizophrenia.[provided by RefSeq, Feb 2010]
• OMIM: 608923

Protein Summary

• Protein general information: Q96RI8  
  • Name: Trace amine associated receptor 6 (TaR 6) (Trace amine receptor 6) (Trace amine receptor 4) (TaR 4)
  • Length: 345  
  • Mass: 38451
  • Tissue specificity: Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippo
• Sequence:

  MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLA
  CADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSG
  ICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVAR
  RQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA
  YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR009132  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000275198
• Other Databases: GeneCards:  TAAR6  Malacards:  TAAR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001594	trace-amine receptor activity	IBA	molecular function
GO:0001594	trace-amine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)