• Gene id: 3191

Gene Summary

• Gene Symbol: HNRNPL   Gene   UCSC   Ensembl
• Aliases: HNRPL, P/OKcl.14, hnRNP-L
• Gene name: heterogeneous nuclear ribonucleoprotein L
• Alternate names: heterogeneous nuclear ribonucleoprotein L, hnRNP L,
• Gene location: 19q13.2 (38852338: 38836377)     Exons: 16     NC_000019.10
• Gene summary(Entrez): Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are sta
• OMIM: 603083

Protein Summary

• Protein general information: P14866  
  • Name: Heterogeneous nuclear ribonucleoprotein L (hnRNP L)
  • Length: 589  
  • Mass: 64,133
• Sequence:

  MSRRLLPRAEKRRRRLEQRQQPDEQRRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG
  GGGGAGAAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGA
  CNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIV
  IFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNP
  NKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPPEY
  GPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKLN
  VCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELG
  VKRPSSVKVFSGKSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS

• Structural information:
  • Protein Domains: RRM (102-176)
    RRM (193-270)
    RRM (382-478)
    RRM (495-583)
  • Interpro: IPR006536  IPR034816  IPR035005  IPR035008  IPR034817   IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12780 cd12785 cd12699 cd12704
  • PDB: 3R27 3TO8
  • PDBsum: 3R27 3TO8
  • DIP: 36355
  • STRING: ENSP00000221419
• Other Databases: GeneCards:  HNRNPL  Malacards:  HNRNPL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0010467	gene expression	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0035770	ribonucleoprotein granule	IDA	cellular component
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045120	pronucleus	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097157	pre-mRNA intronic binding	IDA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0010467	gene expression	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IEA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0035770	ribonucleoprotein granule	IDA	cellular component
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045120	pronucleus	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097157	pre-mRNA intronic binding	IDA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0010467	gene expression	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0035770	ribonucleoprotein granule	IDA	cellular component
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0097157	pre-mRNA intronic binding	IDA	molecular function

Diseases

Associated diseases	References
Azoospermia	MIK: 22245417
Sertoli cell only syndrome (SCOS)	MIK: 22245417
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 22245417
Sertoli cell only syndrome (SCOS)	MIK: 22245417
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22245417	Azoospermia, sertoli cell only syndrome (SCOS)				Male infertility	HnRNPL
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray