About Us

Search Result


Gene id 3185
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol HNRNPF   Gene   UCSC   Ensembl
Aliases HNRPF, OK/SW-cl.23, mcs94-1
Gene name heterogeneous nuclear ribonucleoprotein F
Alternate names heterogeneous nuclear ribonucleoprotein F, HnRNP F protein, nucleolin-like protein mcs94-1,
Gene location 10q11.21 (43409247: 43385616)     Exons: 7     NC_000010.11
Gene summary(Entrez) This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nu
OMIM 601037

Protein Summary

Protein general information P52597  

Name: Heterogeneous nuclear ribonucleoprotein F (hnRNP F) (Nucleolin like protein mcs94 1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N terminally processed]

Length: 415  Mass: 45672

Tissue specificity: Expressed ubiquitously.

Sequence MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDR
ESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGK
ITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQ
AGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQ
VMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD
Structural information
Protein Domains
(13..8-)
(/note="RRM-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
(111..18-)
(/note="RRM-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
(289..36-)
(/note="RRM-3)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
Interpro:  IPR012677  IPR035979  IPR000504  IPR012996  
Prosite:   PS50102

PDB:  
2HGL 2HGM 2HGN 2KFY 2KG0 2KG1 3TFY
PDBsum:   2HGL 2HGM 2HGN 2KFY 2KG0 2KG1 3TFY

DIP:  

33145

MINT:  
STRING:   ENSP00000400433
Other Databases GeneCards:  HNRNPF  Malacards:  HNRNPF

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003723 RNA binding
IBA molecular function
GO:0043484 regulation of RNA splicin
g
IBA biological process
GO:0005654 nucleoplasm
IBA cellular component
GO:1990904 ribonucleoprotein complex
IBA cellular component
GO:0071013 catalytic step 2 spliceos
ome
IDA cellular component
GO:0000398 mRNA splicing, via splice
osome
IC biological process
GO:0043484 regulation of RNA splicin
g
IDA biological process
GO:0003727 single-stranded RNA bindi
ng
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003676 nucleic acid binding
IEA molecular function
GO:0005681 spliceosomal complex
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0006397 mRNA processing
IEA biological process
GO:0008380 RNA splicing
IEA biological process
GO:0003723 RNA binding
IEA molecular function
GO:0003723 RNA binding
TAS molecular function
GO:0005634 nucleus
TAS cellular component
GO:0006396 RNA processing
TAS biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0035722 interleukin-12-mediated s
ignaling pathway
TAS biological process
GO:0000398 mRNA splicing, via splice
osome
TAS biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0016070 RNA metabolic process
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0008134 transcription factor bind
ing
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0017025 TBP-class protein binding
IEA molecular function
GO:0005654 nucleoplasm
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0016020 membrane
HDA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003723 RNA binding
HDA molecular function
GO:0043484 regulation of RNA splicin
g
IMP biological process
Associated diseases References
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract