• Gene id: 3184

Gene Summary

• Gene Symbol: HNRNPD   Gene   UCSC   Ensembl
• Aliases: AUF1, AUF1A, HNRPD, P37, hnRNPD0
• Gene name: heterogeneous nuclear ribonucleoprotein D
• Alternate names: heterogeneous nuclear ribonucleoprotein D0, ARE-binding protein AUFI, type A, AU-rich element RNA binding protein 1, 37kDa, hnRNP D0,
• Gene location: 4q21.22 (82373995: 82352497)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mR
• OMIM: 601324

Protein Summary

• Protein general information: Q14103  
  • Name: Heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) (AU rich element RNA binding protein 1)
  • Length: 355  
  • Mass: 38434
• Sequence:

  MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEE
  DEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESES
  VDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGF
  CFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
  GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

• Structural information:
  • Protein Domains: (97..17-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (182..26-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012956  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 1HD0 1HD1 1IQT 1WTB 1X0F 2Z5N 5IM0
  • PDBsum: 1HD0 1HD1 1IQT 1WTB 1X0F 2Z5N 5IM0
  • DIP: 31163
  • STRING: ENSP00000313199
• Other Databases: GeneCards:  HNRNPD  Malacards:  HNRNPD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:1990837	sequence-specific double-stranded DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0097167	circadian regulation of translation	IMP	biological process
GO:0045727	positive regulation of translation	IMP	biological process
GO:0042752	regulation of circadian rhythm	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0006401	RNA catabolic process	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016070	RNA metabolic process	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:1904355	positive regulation of telomere capping	IEA	biological process
GO:1905663	positive regulation of telomerase RNA reverse transcriptase activity	IEA	biological process
GO:0003680	AT DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0051592	response to calcium ion	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:1901355	response to rapamycin	IEA	biological process
GO:1904383	response to sodium phosphate	IEA	biological process
GO:1904586	cellular response to putrescine	IEA	biological process
GO:1990828	hepatocyte dedifferentiation	IEA	biological process
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0032204	regulation of telomere maintenance	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0001889	liver development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0048255	mRNA stabilization	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IEA	biological process
GO:0071732	cellular response to nitric oxide	IEA	biological process
GO:1904355	positive regulation of telomere capping	ISS	biological process
GO:1905663	positive regulation of telomerase RNA reverse transcriptase activity	ISS	biological process
GO:0032204	regulation of telomere maintenance	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0042162	telomeric DNA binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	NAS	cellular component
GO:0003723	RNA binding	NAS	molecular function

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:20102719
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881