• Gene id: 3182

Gene Summary

• Gene Symbol: HNRNPAB   Gene   UCSC   Ensembl
• Aliases: ABBP1, HNRPAB
• Gene name: heterogeneous nuclear ribonucleoprotein A/B
• Alternate names: heterogeneous nuclear ribonucleoprotein A/B, ABBP-1, APOBEC1-binding protein 1, apobec-1 binding protein 1, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1-binding protein 1, hnRNP A/B, hnRNP type A/B protein,
• Gene location: 5q35.3 (178204532: 178211162)     Exons: 8     NC_000005.10
• Gene summary(Entrez): This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pr
• OMIM: 602688

Protein Summary

• Protein general information: Q99729  
  • Name: Heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) (APOBEC1 binding protein 1) (ABBP 1)
  • Length: 332  
  • Mass: 36225
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGG
  LSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKD
  PVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCE
  IKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGY
  YGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY

• Structural information:
  • Protein Domains: (69..15-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (153..23-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012956  IPR034846  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12757
  • PDB: 3S7R
  • PDBsum: 3S7R
  • DIP: 50394
  • STRING: ENSP00000351108
• Other Databases: GeneCards:  HNRNPAB  Malacards:  HNRNPAB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	ISS	contributes to
GO:0043565	sequence-specific DNA binding	ISS	contributes to
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0001837	epithelial to mesenchymal transition	ISS	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:1990837	sequence-specific double-stranded DNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0003729	mRNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:24638979
hepatocellular carcinoma	PMID:24638979
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray